BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120462.Seq (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 106 2e-23 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 106 bits (254), Expect = 2e-23 Identities = 52/95 (54%), Positives = 64/95 (67%) Frame = +1 Query: 454 IIFNYFIRXLFYYFTSI*NIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRH 633 ++ + +F F + +A FTI+D IYGSTFF+ATGFHG HVIIGTLFL+IC IR Sbjct: 166 LVATVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQ 225 Query: 634 LNNHFSKNHHFGFEAAA*Y*HFVDVDDYFFTFLFI 738 H +K HH GFEAAA Y HFVDV + FLF+ Sbjct: 226 YLGHLTKEHHVGFEAAAWYWHFVDV---VWLFLFV 257 Score = 64.1 bits (149), Expect = 1e-10 Identities = 33/78 (42%), Positives = 43/78 (55%) Frame = +2 Query: 275 HRRLSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQR 454 H L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ + Sbjct: 106 HSSLAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYA 165 Query: 455 LFLTILLGFYFTILQAYE 508 L T+LL FT Q E Sbjct: 166 LVATVLLALVFTGFQGME 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,089,591 Number of Sequences: 28952 Number of extensions: 172749 Number of successful extensions: 255 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -