BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120456.Seq (763 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28145| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.5e-05) 33 0.33 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_58467| Best HMM Match : 7tm_1 (HMM E-Value=3.6e-10) 29 5.5 SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 28 7.2 SB_24621| Best HMM Match : DUF164 (HMM E-Value=0.39) 28 7.2 SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_28145| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.5e-05) Length = 340 Score = 32.7 bits (71), Expect = 0.33 Identities = 22/71 (30%), Positives = 35/71 (49%) Frame = -3 Query: 497 VLYSFSGRYTFEYNKHGFKFLDIKVCGAARHGHITRCAGRVWRFNSIVVYGAQKNAVSAH 318 ++ S+ R +FE NK+ ++ K C G+I G + +VV G+ NA+ Sbjct: 203 LMRSYKFRLSFE-NKNCVDYITEKYCYPLEKGNIPIVLGGASYDSKLVVPGSYINALDFP 261 Query: 317 FVGALFDYVVY 285 V AL DY+ Y Sbjct: 262 SVKALADYIQY 272 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 620 SCTPECSWICAIRAPLVRTAAPCWGRSSTQSCCRLRIEHAIV 495 +C E W+ L+R WGR +C R I+H ++ Sbjct: 238 TCQGEKQWLQCPPYQLIRVNNAFWGRDDPTTCTRSGIQHGLI 279 >SB_58467| Best HMM Match : 7tm_1 (HMM E-Value=3.6e-10) Length = 340 Score = 28.7 bits (61), Expect = 5.5 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%) Frame = -1 Query: 499 LSSTVLVGVIPLNTINMDLNSLISKFAVPRVMVTLLDVLAAFGDLTP*SYTVPRKMLLVP 320 L S +LV +I L+ +N+ + SL+ VPR + LL AF D +LL P Sbjct: 35 LVSLLLVVIIGLS-LNLSVISLVMMKKVPRRNMNLLVANMAFSDFL--------SLLLEP 85 Query: 319 TLLEPSLTMSS--IDSGFSAIYICSIYYRRVRCANW 218 + L +T++S I + A C Y + + W Sbjct: 86 SSLLSQMTVNSPWIGVSYLADVTCKFYTFVMNTSTW 121 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 28.3 bits (60), Expect = 7.2 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +3 Query: 261 YIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVTMTRGTANFDIKE 440 +I K L+++ I K+ N GT+ + T DYG S N N R T ++E Sbjct: 1382 HIGRKTLAVNKIDKDDDNDDGTDEVVKQTFDDYG--SRNEVVWHGNRIQERSTKRAALEE 1439 >SB_24621| Best HMM Match : DUF164 (HMM E-Value=0.39) Length = 566 Score = 28.3 bits (60), Expect = 7.2 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +3 Query: 594 NPTALWCTRKTRQLSKFYWKITLPLLMLTKPPIS---KTINHTEK*I**TKK 740 N T + T+K L+K +T LL LTK P+S K ++ T+K + TKK Sbjct: 26 NSTLVHHTKKPLSLTKKLLSLTKKLLSLTKKPLSLTKKLLSLTKKPLSLTKK 77 >SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 178 SRLIPPIR-CSALNWATPRLRNLNLMHSSNRDKSVRAKRSI 59 S ++PP R S+ W PR RNL + S R K R +R++ Sbjct: 156 SVVLPPHRLASSTKWTRPR-RNLEVGDISTRQKWTRPRRNL 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,237,050 Number of Sequences: 59808 Number of extensions: 497051 Number of successful extensions: 1530 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1475 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -