BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120456.Seq (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 2.5 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 5.9 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 5.9 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.8 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 614 TPECSWICAIRAPLVRTAAPCWGRSSTQSCCR 519 T C + A+ +R AAP W + T CR Sbjct: 788 TSRCRLLAAVADSTMRYAAPVWHGALTNRECR 819 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -3 Query: 614 TPECSWICAIRAPLVRTAAPCWGRSSTQSCCRLRIE 507 T + + ++ ++R AAP W T+ CR +E Sbjct: 840 TSKARLLASVAESVIRYAAPIWHGEVTKRECRRLLE 875 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 596 ICAIRAPLVRTAAPCWGRSSTQSCCR 519 + A+ A ++R AP W ++ CR Sbjct: 789 LAAVAASIIRYGAPVWTEATDLQWCR 814 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.8 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = -1 Query: 325 VPTLLEPSLTMSSIDSGFSAIYICSIYYRRVRCANWPPGRY*ALRLIVCSRLIPPIRCSA 146 V T+ E M +I + +IC+ R R P + ++C L +R S+ Sbjct: 62 VATIAEMDRIMGNIAGNSTEAFICTPVLSRQRATRAPTTSTWTSKSVLCEELFLFLRRSS 121 Query: 145 L 143 L Sbjct: 122 L 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,946 Number of Sequences: 2352 Number of extensions: 17255 Number of successful extensions: 45 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -