BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120456.Seq (763 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical... 30 2.1 AC024798-2|AAK29923.1| 352|Caenorhabditis elegans Hypothetical ... 29 4.8 Z19154-8|CAE17741.1| 335|Caenorhabditis elegans Hypothetical pr... 28 6.3 >AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical protein Y45F10B.10 protein. Length = 1592 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 302 FDYVVYR*RFFGNIHLLNLLSPCAMRKL 219 F+YV Y R+FG HLL+L CA + L Sbjct: 750 FEYVDYVTRYFGISHLLSLYEECATQIL 777 >AC024798-2|AAK29923.1| 352|Caenorhabditis elegans Hypothetical protein Y48G9A.9a protein. Length = 352 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 109 NLNSLTEASPSLGQSSESVESDENKRLNVK-LNNARVANLRI 231 N N++ E P+ QSS E+D++ R V+ LNN +A ++ Sbjct: 17 NNNNVNEKRPASAQSSNGTETDDHHRKYVETLNNFIIATEKL 58 >Z19154-8|CAE17741.1| 335|Caenorhabditis elegans Hypothetical protein C40H1.9 protein. Length = 335 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +3 Query: 579 CANCANPTALWCTRKTRQLSKFY---WKITLPLLMLTKPPI 692 C+NC +WC +++ S F KI+L L TKP + Sbjct: 25 CSNCVGSGQVWCVEQSQCNSSFVSCSTKISLQLNCPTKPKV 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,362,230 Number of Sequences: 27780 Number of extensions: 372943 Number of successful extensions: 1148 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1146 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -