BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120455X.Seq (387 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41538-3|AAP31431.1| 142|Caenorhabditis elegans Hypothetical pr... 29 1.1 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 29 1.1 U97002-4|AAB52267.1| 630|Caenorhabditis elegans Hypothetical pr... 27 4.6 >U41538-3|AAP31431.1| 142|Caenorhabditis elegans Hypothetical protein R04E5.8b protein. Length = 142 Score = 29.1 bits (62), Expect = 1.1 Identities = 20/54 (37%), Positives = 23/54 (42%), Gaps = 8/54 (14%) Frame = +1 Query: 28 SRQHH--PPRRHNGSPS------GNRHQQFPSQASTLPISGKFQAHDINNQQSQ 165 +R HH PPR HN + GNRHQ + Q HD N QSQ Sbjct: 71 NRGHHHGPPRNHNQDRNRHRNHDGNRHQNQDRSRHHNQDRNRRQNHDRNRHQSQ 124 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 29.1 bits (62), Expect = 1.1 Identities = 20/54 (37%), Positives = 23/54 (42%), Gaps = 8/54 (14%) Frame = +1 Query: 28 SRQHH--PPRRHNGSPS------GNRHQQFPSQASTLPISGKFQAHDINNQQSQ 165 +R HH PPR HN + GNRHQ + Q HD N QSQ Sbjct: 915 NRGHHHGPPRNHNQDRNRHRNHDGNRHQNQDRSRHHNQDRNRRQNHDRNRHQSQ 968 >U97002-4|AAB52267.1| 630|Caenorhabditis elegans Hypothetical protein K09H11.4 protein. Length = 630 Score = 27.1 bits (57), Expect = 4.6 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 25 LSRQHHPPRRHNGSPSGNRHQQFPSQASTLPISGKF 132 + + HPP+ H GSP Q P P G+F Sbjct: 528 VEHEQHPPQSH-GSPHPGPQYQGPPPRKEFPTPGRF 562 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,268,886 Number of Sequences: 27780 Number of extensions: 151005 Number of successful extensions: 283 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -