BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120454.Seq (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.76 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 25 1.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 1.8 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 23 4.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.4 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 9.4 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.76 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +2 Query: 113 HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDVDAGESI 274 H HQ + Q +A+ + +QQ QQQ + + Q+ T+ D +I Sbjct: 815 HHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQQQRGPMTNDDFNPNI 868 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 122 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 247 Q+ QQ+ + + QQ +PQQQ + + QQ+Q+ Sbjct: 1507 QQQQQQQQQQPQQQSQQPQQQQPQPQQQQQQQQQQQPQQQQK 1548 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +2 Query: 119 HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 247 HQ+ + Q +A A+ Q + QQQ + QQ+Q+ Sbjct: 811 HQQLHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQ 853 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 134 LQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 247 LQ++ R A +QQ + QQQ + + QQ+ + Sbjct: 1198 LQEQQRNAAMVQQQQQQQQQQQQQQQQQQQQQQQQQHQ 1235 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 24.6 bits (51), Expect = 1.0 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +3 Query: 135 YNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTSTPANLFGTTNV--WI 296 Y + P Y+ T+D ++ S +N+V A K+ E ++ F + V W+ Sbjct: 454 YKSYPNYIDKETKDMNLEISTRPKSNTVENACVLKNTEIFKDKSDWFDYSEVSKWV 509 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 219 AIAPYNKSKEPTSTPANLFGTTNVWILFKKLLD 317 A+ NKSK T P N + ++W K L + Sbjct: 301 ALQEMNKSKSITEPPKNCADSGSIWETGKNLFE 333 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +2 Query: 122 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 247 Q+ + QQ+ + + +A+Q + QQQ + + QQ+Q+ Sbjct: 421 QQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQQQQ 462 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 122 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 247 Q+ QQ+ + + N +PQQQ + + QQ+Q+ Sbjct: 416 QQMQAQQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQ 457 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 144 APGYVPPTTRDNKMD 188 +PGYV P T+ K+D Sbjct: 113 SPGYVQPPTKHQKLD 127 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +2 Query: 134 LQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 247 +++R R + + R + + QQQ + D+ QQ+ R Sbjct: 72 MREREREQREHSDRVTSQQQQQQQQQQQQDQQQQQQSR 109 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 167 DARQQNGHEPQQQHKLGSDRTVQQEQRTDVDAGE 268 DAR + HE + +R + + RT +++GE Sbjct: 374 DARIFSPHEENESVDKHPNRRARGQLRTKIESGE 407 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 167 DARQQNGHEPQQQHKL 214 DAR++ G P+QQ +L Sbjct: 171 DARKKKGPTPRQQEEL 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,584 Number of Sequences: 438 Number of extensions: 4672 Number of successful extensions: 25 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -