BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120453.Seq (782 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000069F87E Cluster: Probable helicase senataxin (EC ... 33 8.1 >UniRef50_UPI000069F87E Cluster: Probable helicase senataxin (EC 3.6.1.-) (SEN1 homolog).; n=2; Xenopus tropicalis|Rep: Probable helicase senataxin (EC 3.6.1.-) (SEN1 homolog). - Xenopus tropicalis Length = 2359 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 13 IFHGSDESMVYRSKQTELKEKKLQPLC-LCVHSRTNKER*RFIKVKCIV 156 ++H S RS +T+ +EK+ LC LC+H++ N R +V+C V Sbjct: 1720 VYHTGYVSRFNRSHRTQSQEKEQYTLCDLCIHTQGNLSAFRNQQVRCAV 1768 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,284,259 Number of Sequences: 1657284 Number of extensions: 13565648 Number of successful extensions: 26253 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26243 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66262109095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -