BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120453.Seq (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 25 0.68 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 3.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 6.4 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 25.0 bits (52), Expect = 0.68 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = -2 Query: 712 KTYKLLREHKYIVFGYIINKIICQL*TQLVLIVQK*F---QDEMTRVGTSRYFPMDMSLP 542 K Y++L H +F + N C L T+LVL++Q F ++T++ + S Sbjct: 160 KYYQIL-SHLSGIFFTVFNVAQCYLTTELVLMLQTRFVILNKQLTKITVKNFATKTQSA- 217 Query: 541 TFYVC*KLYKYQHYIALMVT 482 V K+ H+++ +VT Sbjct: 218 ---VLGKICTLHHHLSKLVT 234 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = -2 Query: 112 FCCAHTNITAGVSFLLTL-FVYC 47 FCCA T + FLL + + YC Sbjct: 268 FCCAFIIFTMHLLFLLCIYYFYC 290 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 598 LEITFVLLKRAVFTVGKLFY**YSQKRYIY 687 L +T VL AVF + LFY + K++IY Sbjct: 2 LVLTTVLTAAAVFLLFYLFYCYKTIKQHIY 31 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 598 LEITFVLLKRAVFTVGKLFY**YSQKRYIY 687 L +T VL AVF + LFY + K++IY Sbjct: 2 LVLTTVLTAAAVFLLFYLFYCYKTIKQHIY 31 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 85 PLCLCVHSRTNKER*RFIKV 144 P L + SR+NKE RF+KV Sbjct: 208 PGVLGLLSRSNKESQRFLKV 227 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 85 PLCLCVHSRTNKER*RFIKV 144 P L + SR+NKE RF+KV Sbjct: 208 PGVLGLLSRSNKESQRFLKV 227 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 85 PLCLCVHSRTNKER*RFIKV 144 P L + SR+NKE RF+KV Sbjct: 208 PGVLGLLSRSNKESQRFLKV 227 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 85 PLCLCVHSRTNKER*RFIKV 144 P L + SR+NKE RF+KV Sbjct: 208 PGVLGLLSRSNKESQRFLKV 227 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 404 KVEYWLRIQIKLL*FLT*YVCTIIVYCD 487 K E +L I L+ + + CT+I+ CD Sbjct: 231 KFEPFLISNISLVSLIFLFNCTLIIMCD 258 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,702 Number of Sequences: 336 Number of extensions: 4150 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -