BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120449.Seq (610 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar... 33 0.033 SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Sc... 27 2.1 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 26 5.0 >SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 33.1 bits (72), Expect = 0.033 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +2 Query: 2 RQAKDLVSVLQEANQIISPQLQSMA 76 +QA++LVS+L EA Q I P+L+ MA Sbjct: 479 KQARELVSILSEAKQDIDPKLEEMA 503 >SPAC23E2.01 |fep1|gaf2|iron-sensing transcription factor Fep1|Schizosaccharomyces pombe|chr 1|||Manual Length = 564 Score = 27.1 bits (57), Expect = 2.1 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 191 PFGYSCQNCFRV*KSRHHLG-HLYRIC-SCSTRRHHHRNGRP 72 PFG SC NC + S G +C +C + H ++ RP Sbjct: 7 PFGQSCSNCHKTTTSLWRRGPDNSLLCNACGLYQKHRKHARP 48 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.8 bits (54), Expect = 5.0 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 272 ITRIHPLEMPTKILFNSRQIVCNHCRPP-FGYSCQN 168 +++ H E+ K S +I+CN CR P F +S +N Sbjct: 757 LSKNHTGEITRKATEPSIRIICNFCRKPIFPFSNRN 792 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,112,257 Number of Sequences: 5004 Number of extensions: 38405 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -