BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120449.Seq (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 35 0.059 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 29 2.2 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = +2 Query: 2 RQAKDLVSVLQEANQIISPQLQSMAD 79 +QAK+LVSVLQEA Q ++P+L ++ D Sbjct: 396 KQAKELVSVLQEAKQHVNPKLLNLQD 421 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 209 CNHCRPPFGYSCQNCFRV*KSRHH 138 C C P F Y C+NCFRV +S H Sbjct: 1199 CKTC-PDFDY-CENCFRVRRSHRH 1220 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = -3 Query: 245 PTKILFNSRQIVCNHCRPPFGYSCQNCFRV*KSRHHLGHLYRICSCSTRRHHHRNGR 75 P++ L R + NH RP + +C R S HH + C C +HHR R Sbjct: 228 PSRHLHCHRPRLSNHHRPSRHH---HCHRPRLSNHHRPSRHLHCHCPRLSNHHRLSR 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,489,873 Number of Sequences: 59808 Number of extensions: 281450 Number of successful extensions: 484 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -