BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120448.Seq (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 2.5 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 4.3 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 5.7 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.6 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 609 TPECSWICAIRAPLVRTAAPCWGRSSTQSCCR 514 T C + A+ +R AAP W + T CR Sbjct: 788 TSRCRLLAAVADSTMRYAAPVWHGALTNRECR 819 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 252 WLNLLSPCAMRKLATRALLSFTFNRLFSSDSTDSLLCPK 136 WL S A++K A+ +S F+R+ D CP+ Sbjct: 100 WLVTASQSALQKFASTDWMSNPFDRVVCGDFAGPNGCPR 138 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 591 ICAIRAPLVRTAAPCWGRSSTQSCCR 514 + A+ A ++R AP W ++ CR Sbjct: 789 LAAVAASIIRYGAPVWTEATDLQWCR 814 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 7.6 Identities = 18/68 (26%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +1 Query: 244 IEPKYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTAN 420 + P + + + + S VG S + V D SP + S N +MT+ + Sbjct: 612 VVPGAVGVRSIGPGVVESTASIAVGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSY 671 Query: 421 FDIKEFKS 444 DIKE S Sbjct: 672 SDIKEATS 679 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 7.6 Identities = 18/68 (26%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +1 Query: 244 IEPKYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTAN 420 + P + + + + S VG S + V D SP + S N +MT+ + Sbjct: 612 VVPGAVGVRSIGPGVVESTASIAVGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSY 671 Query: 421 FDIKEFKS 444 DIKE S Sbjct: 672 SDIKEATS 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,216 Number of Sequences: 2352 Number of extensions: 15985 Number of successful extensions: 42 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -