BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120448.Seq (746 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-3712|AAF56394.1| 328|Drosophila melanogaster CG9996-PA... 29 8.9 >AE014297-3712|AAF56394.1| 328|Drosophila melanogaster CG9996-PA protein. Length = 328 Score = 28.7 bits (61), Expect = 8.9 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -3 Query: 297 FDYVVYR*RF-FGN-ILWLNLLSPCAMRKLATRALLSFTFNRLFSSDSTDSLLCPKLGDA 124 FD+ + +F GN + W NL PCA ++L +LL+ + L+ TD L + D Sbjct: 74 FDFEILPLKFPSGNEVEWRNLFKPCAAQRLFLPSLLTHVDSLLYV--DTDILFLSPISDI 131 Query: 123 SVKEFKFN 100 KFN Sbjct: 132 WRFFKKFN 139 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,418,816 Number of Sequences: 53049 Number of extensions: 683468 Number of successful extensions: 1668 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1668 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3396574665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -