BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120446.Seq (671 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z34799-3|CAA84316.3| 539|Caenorhabditis elegans Hypothetical pr... 29 2.3 AL110479-3|CAB60312.2| 330|Caenorhabditis elegans Hypothetical ... 27 9.2 >Z34799-3|CAA84316.3| 539|Caenorhabditis elegans Hypothetical protein F34D10.6 protein. Length = 539 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 235 GIEPRVLKR*RDVDLEERDATVL 303 GIEP VL R + VD++ RD TVL Sbjct: 307 GIEPDVLNRIQGVDVKNRDFTVL 329 >AL110479-3|CAB60312.2| 330|Caenorhabditis elegans Hypothetical protein Y105C5B.4 protein. Length = 330 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +2 Query: 434 GMVPAGVL*TISSAYCKNSLTAKITNAFYL*WAHFCIFYKMQKHANF*LANF 589 G++P + ++S + K + N YL A+F +FY ++K N +ANF Sbjct: 174 GIIPRFIDKQMTSTFFKIGGSFLFLNCLYLIIAYFYLFYSLKKR-NSRIANF 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,095,643 Number of Sequences: 27780 Number of extensions: 270198 Number of successful extensions: 534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -