BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120444.Seq (819 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U52001-1|AAA96093.1| 656|Caenorhabditis elegans Feminization of... 31 0.75 J03172-1|AAA28055.1| 656|Caenorhabditis elegans protein ( C.ele... 31 0.75 AC024790-2|AAF60638.1| 220|Caenorhabditis elegans Ground-like (... 30 2.3 Z69361-2|CAA93288.1| 2165|Caenorhabditis elegans Hypothetical pr... 29 5.3 Z69360-10|CAA93287.1| 2165|Caenorhabditis elegans Hypothetical p... 29 5.3 U41542-10|AAX88836.1| 486|Caenorhabditis elegans Nuclear hormon... 29 5.3 U41542-9|AAK39150.3| 542|Caenorhabditis elegans Nuclear hormone... 29 5.3 AY305836-1|AAR11981.1| 487|Caenorhabditis elegans nuclear recep... 29 5.3 AF273781-1|AAG15130.1| 508|Caenorhabditis elegans nuclear recep... 29 5.3 AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical... 28 9.2 >U52001-1|AAA96093.1| 656|Caenorhabditis elegans Feminization of xx and xo animalsprotein 1, isoform a protein. Length = 656 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +3 Query: 270 NHHRGDGLQRKRDYWLQGVLPGVCVQRRLAGSQHTRRRIHENADCGQRRFAH 425 NHH L R R W++ V GVC++ A + + + CG+ R H Sbjct: 408 NHHANRNL-RVRSSWVKYVFNGVCLELERAAAWTGAPLLEDTECCGKERCQH 458 >J03172-1|AAA28055.1| 656|Caenorhabditis elegans protein ( C.elegans fem-1 gene,complete cds. ). Length = 656 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +3 Query: 270 NHHRGDGLQRKRDYWLQGVLPGVCVQRRLAGSQHTRRRIHENADCGQRRFAH 425 NHH L R R W++ V GVC++ A + + + CG+ R H Sbjct: 408 NHHANRNL-RVRSSWVKYVFNGVCLELERAAAWTGAPLLEDTECCGKERCQH 458 >AC024790-2|AAF60638.1| 220|Caenorhabditis elegans Ground-like (grd related) protein 5 protein. Length = 220 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -2 Query: 218 FCTDPFSFARCSAPPQRQNAPPPKA 144 F P FA SAPPQ APPP+A Sbjct: 86 FAAQPAQFAVQSAPPQPIVAPPPQA 110 >Z69361-2|CAA93288.1| 2165|Caenorhabditis elegans Hypothetical protein F25H8.3 protein. Length = 2165 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 464 NSSPTSHCCLIPHMSKSSLPTVSVFMDSSTRVLG 363 N P SH +PH S S+ + +++DS V G Sbjct: 127 NQIPDSHNKSVPHFSNSNFAPMVLYLDSEEEVRG 160 >Z69360-10|CAA93287.1| 2165|Caenorhabditis elegans Hypothetical protein F25H8.3 protein. Length = 2165 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 464 NSSPTSHCCLIPHMSKSSLPTVSVFMDSSTRVLG 363 N P SH +PH S S+ + +++DS V G Sbjct: 127 NQIPDSHNKSVPHFSNSNFAPMVLYLDSEEEVRG 160 >U41542-10|AAX88836.1| 486|Caenorhabditis elegans Nuclear hormone receptor familyprotein 35, isoform b protein. Length = 486 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 113 LCVSYRSLGMTDLLVALRHLIYPTA 39 LCV+YRS+G D L L L P A Sbjct: 224 LCVAYRSVGANDALKLLNDLYIPRA 248 >U41542-9|AAK39150.3| 542|Caenorhabditis elegans Nuclear hormone receptor familyprotein 35, isoform a protein. Length = 542 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 113 LCVSYRSLGMTDLLVALRHLIYPTA 39 LCV+YRS+G D L L L P A Sbjct: 280 LCVAYRSVGANDALKLLNDLYIPRA 304 >AY305836-1|AAR11981.1| 487|Caenorhabditis elegans nuclear receptor NHR-35 protein. Length = 487 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 113 LCVSYRSLGMTDLLVALRHLIYPTA 39 LCV+YRS+G D L L L P A Sbjct: 225 LCVAYRSVGANDALKLLNDLYIPRA 249 >AF273781-1|AAG15130.1| 508|Caenorhabditis elegans nuclear receptor NHR-35 protein. Length = 508 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 113 LCVSYRSLGMTDLLVALRHLIYPTA 39 LCV+YRS+G D L L L P A Sbjct: 246 LCVAYRSVGANDALKLLNDLYIPRA 270 >AL032623-16|CAA21511.2| 1816|Caenorhabditis elegans Hypothetical protein Y43F8B.3a protein. Length = 1816 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 544 NSLPLTHWPRPSCRENTHRCHCP 476 NS PLTHW P +T C CP Sbjct: 657 NSCPLTHWCHPGPDASTTMC-CP 678 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,305,326 Number of Sequences: 27780 Number of extensions: 379615 Number of successful extensions: 1111 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2019417216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -