BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120442.Seq (766 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1187 + 24667044-24667091,24667196-24667274,24667520-246676... 29 4.1 09_06_0309 - 22206812-22206884,22207008-22207103,22207531-222076... 28 7.1 >07_03_1187 + 24667044-24667091,24667196-24667274,24667520-24667695, 24668216-24668766,24669080-24669941 Length = 571 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 616 RNLWLFRNNLCYTSNWV--IRIHCLSSSYIHC 705 + LWL+R+ + +WV RI C S+ HC Sbjct: 24 QRLWLYRSRFGFYYSWVWGYRISCFRSTQSHC 55 >09_06_0309 - 22206812-22206884,22207008-22207103,22207531-22207619, 22207738-22207820,22207932-22208048,22208132-22208319, 22208430-22208500,22208570-22208782,22210022-22210081, 22210186-22210476,22210590-22211894 Length = 861 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 475 HFLILLEEETQFISTFILIFWT 540 H L+L F STF+L+FWT Sbjct: 570 HSLLLSSRIGMFFSTFLLLFWT 591 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,946,434 Number of Sequences: 37544 Number of extensions: 265097 Number of successful extensions: 471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -