BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120442.Seq (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 30 1.8 SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) 29 5.4 SB_7244| Best HMM Match : YL1 (HMM E-Value=0.57) 28 7.2 SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) 28 9.5 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 718 DTRAYFTSATIIIAGP 765 DTRAYFT+AT+IIA P Sbjct: 4 DTRAYFTAATMIIAVP 19 >SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) Length = 371 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 535 WTS*SLYFNFTRIWDNFPYYFTRKRKKRNLWLFRNNLCYTSNWVI 669 W++ LY + +W N Y + N L+ N+ C SN VI Sbjct: 326 WSNAVLYTYHSCLWSNAVLYTNHSCLRSNAVLYTNHSCLRSNAVI 370 >SB_7244| Best HMM Match : YL1 (HMM E-Value=0.57) Length = 412 Score = 28.3 bits (60), Expect = 7.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 630 QPKVSFFPLSCEIIWEIIPNPGKIK 556 Q + F +C++ WE++ PGK K Sbjct: 51 QEAIDKFEKACDVYWEVLDKPGKRK 75 >SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) Length = 414 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 143 GGRSQNLILFIRGNAISGAPSI 78 GG S+NLI F G I G PS+ Sbjct: 99 GGESKNLINFALGQDIGGVPSV 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,687,549 Number of Sequences: 59808 Number of extensions: 295313 Number of successful extensions: 651 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -