BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120442.Seq (766 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067618-6|AAC19197.2| 1015|Caenorhabditis elegans Hypothetical ... 29 4.8 AF100675-1|AAC69003.2| 370|Caenorhabditis elegans Hypothetical ... 28 8.4 >AF067618-6|AAC19197.2| 1015|Caenorhabditis elegans Hypothetical protein F56H1.5 protein. Length = 1015 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 592 YFTRKRKKRNLWLFRNNLCYTSNWVIRIHCLSSS 693 +FT K K+ L R N+C V+R H SSS Sbjct: 245 FFTMKNKRTRTQLLRENICKYLLEVLRRHLASSS 278 >AF100675-1|AAC69003.2| 370|Caenorhabditis elegans Hypothetical protein Y55H10A.2 protein. Length = 370 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 481 LILLEEETQFISTFILIFWTS*SLY-FNFTRIWDNFPYYFTRKRKKRNLWLFRNNLCYTS 657 L+L + F + + + + S LY ++ NF Y R R+ RN+ LF+ C Sbjct: 233 LLLFPDILLFANPWNITKFYSTPLYTMTLSKTMVNFMIYMIRYRELRNIILFKIIACLPQ 292 Query: 658 NWVI 669 W I Sbjct: 293 KWSI 296 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,900,580 Number of Sequences: 27780 Number of extensions: 237680 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -