BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120438.Seq (792 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2427| Best HMM Match : zf-C3HC4 (HMM E-Value=0.3) 32 0.46 SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) 31 0.81 SB_41318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_39577| Best HMM Match : DUF1213 (HMM E-Value=0.54) 31 1.4 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) 30 2.5 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 30 2.5 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 3.3 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 3.3 SB_51079| Best HMM Match : zf-C3HC4 (HMM E-Value=0.19) 29 4.3 SB_47268| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_5023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) 29 5.7 SB_29559| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 29 5.7 SB_24355| Best HMM Match : SAM_2 (HMM E-Value=3e-07) 29 5.7 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 28 7.5 SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_17494| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 28 10.0 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 28 10.0 >SB_2427| Best HMM Match : zf-C3HC4 (HMM E-Value=0.3) Length = 378 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = +2 Query: 485 GQICKQFCKYKKTTEQHMSDSRCTTCNYRFKDNTRAWFLYVVVHIEKPLDD 637 GQ C Q C +K C C Y F D TR L+V + + DD Sbjct: 53 GQSCHQQCFWKWIHTHRTERITCPHCRYVFPDTTRGVVLWVDSNFKPMYDD 103 >SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) Length = 818 Score = 31.5 bits (68), Expect = 0.81 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 4/82 (4%) Frame = +1 Query: 97 KGRVKSLPTPVANSPLSPVRQP----PKSNIKPPTRISLPTRTFSANPLERSISSSM*VK 264 + R SLP A+SP +P P P SN PP+ +SL R + + + Sbjct: 676 RARSLSLPCTAASSPSTPASSPSPTPPLSNSLPPSTLSLMLRKKRTSNAFDINNIVIPYS 735 Query: 265 NQSSTEKMDILCRPSLVTNWKV 330 SST + + L NW+V Sbjct: 736 MASSTRVEKLQYKEILTPNWRV 757 >SB_41318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +2 Query: 485 GQICKQFCKYKKTTEQHMSDSRCTTCNYRFKDNTRAWFLYVVVHIEKPLDD 637 GQ+C Q C +K D C C + F TR L++ + +D Sbjct: 53 GQVCHQQCFWKWIHFHRTEDITCPHCRHAFPSTTRGVVLWIDSNFNPKYED 103 >SB_39577| Best HMM Match : DUF1213 (HMM E-Value=0.54) Length = 240 Score = 30.7 bits (66), Expect = 1.4 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 1/103 (0%) Frame = +1 Query: 40 TMNRFFRENNIFDAPKTGGKG-RVKSLPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTF 216 T R + ++ +PKT K R+KSL T SP R PK++ K + S P + Sbjct: 88 TSRRTSLKRSLKTSPKTSPKTMRMKSLKTSPKTSPEIGPRTSPKTSSKTSPKTS-PKSSP 146 Query: 217 SANPLERSISSSM*VKNQSSTEKMDILCRPSLVTNWKVCPRTA 345 +P S +S + S R SL + K P+T+ Sbjct: 147 KTSPKTSSKTSLKTSQKTSLNASRKTSRRTSLKRSLKTSPKTS 189 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 115 LPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANPLERSISSS 252 LP P + PL P + PP S I P+++S + +P +SS+ Sbjct: 1354 LPPPHSRLPLPPPKLPPPSRIPLPSKLS-TNKDIKFHPYHNVVSST 1398 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 8/40 (20%) Frame = +1 Query: 115 LPTPVANSPLSPVRQPPKSN--------IKPPTRISLPTR 210 LP P+ PL P+R PP + + PP+RI LP++ Sbjct: 1340 LPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIPLPSK 1379 >SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +1 Query: 106 VKSLPT-PVANSPLSPVRQPPKSNI-KPPTR--ISLPTRTFSANPLERSISS 249 + S PT P+ + P SP+ PP + I PPT +S PT + + P +S+ Sbjct: 16 IMSPPTNPIMSPPTSPIMSPPTNPIMSPPTNPIMSPPTNSIMSAPTNSIMSA 67 >SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) Length = 553 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +1 Query: 16 IFEC*PTVTMNRFFRENNIFDAPKTGGKGRVKSLPTPVANSP----LSPVRQPPKSNIKP 183 + C P V+ E + P+ K +PT SP +PVR+ P+ KP Sbjct: 488 VLPCTPVVSSKPILPEPEVTPLPEVSPKSSETVVPTCTTESPPDVASTPVRRYPRRTPKP 547 Query: 184 PTRISL 201 R+ L Sbjct: 548 VVRLDL 553 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +2 Query: 518 KTTEQHMSDSRCTTCNYRFKDNTRAWFLYVVVHIEKPLDDSDRIDICCQKC 670 K E + S+CTTCN ++ F Y+ K I C+KC Sbjct: 208 KKAEPGTTHSKCTTCNGTGQETVNTGFFYMKSTCRKCAGQGYIISTPCRKC 258 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +3 Query: 219 GQSVGAQHQQQHVSKKPVVNRKDGYFVPPEFGNKLESLPAYSD-KLDFKQERDLRMHFMS 395 GQS+ A +V+ KP V + P F K + +PA + K + +QE ++ H + Sbjct: 47 GQSLAADFNSLNVNAKPFVPNVNAPSFVPSFLTKPDPVPAQEEAKENVQQEIEVE-HKQN 105 Query: 396 DLERNIMKATL 428 D E +++ L Sbjct: 106 DQEEEVVEDAL 116 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 79 APKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPPTR-ISLPTRTFSANP 228 AP G R P P N P P+R P PP + P + S+NP Sbjct: 230 APPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNP 280 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 79 APKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPPTR-ISLPTRTFSANP 228 AP G R P P N P P+R P PP + P + S+NP Sbjct: 142 APPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNP 192 >SB_51079| Best HMM Match : zf-C3HC4 (HMM E-Value=0.19) Length = 337 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 485 GQICKQFCKYKKTTEQHMSDSRCTTCNYRFKDNTRAWFLYVVVHIEKPLDD 637 GQ+C Q C +K C C + F +T+ L+V + + DD Sbjct: 52 GQVCHQQCFWKWAHYHRTEAVTCPHCRHVFPSSTKEIVLWVDSNFKPKYDD 102 >SB_47268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/88 (26%), Positives = 44/88 (50%) Frame = +1 Query: 58 RENNIFDAPKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANPLER 237 ++ + +PKTG + + +LP V + SPV++P KS +KP +++ +T P Sbjct: 533 KKETVHWSPKTGVEEK-NTLP--VVPTWKSPVKKPTKSTVKPLPKLA---KTTFKPPSTT 586 Query: 238 SISSSM*VKNQSSTEKMDILCRPSLVTN 321 I + +K + + + PSLV + Sbjct: 587 KIEGASELKPRKMPKLVKPFVTPSLVVS 614 >SB_39878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 707 IYPSINLVDLSYLARERFLPIHFP 778 ++PSI +V+L LA ER+L + FP Sbjct: 599 LFPSITIVNLFALAVERYLGVFFP 622 >SB_5023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/112 (17%), Positives = 45/112 (40%), Gaps = 4/112 (3%) Frame = +2 Query: 431 IFHQLHYGLYKQ*RYAHDGQICKQFCKYKKTTEQHMSDSRCTTCNYRFKDNTRAWFLYVV 610 ++H Y Y Y H + +Y +++ H+ T RF ++ + +Y + Sbjct: 342 MYHMTSYAQYNSSSYYHLMYHMTSYAQYNSSSDYHLMYH--MTSYARFNSSSYYYLMYHM 399 Query: 611 VHIEKPLDDSDRIDICC----QKCYLYHNVPKTSYEIYPSINLVDLSYLARE 754 + SD + YL +++P +Y +Y I + ++ L ++ Sbjct: 400 TSYAQYNSSSDYYLMSYVPHNANYYLMYHIPHNAYVLYTPIRMFTITLLVKQ 451 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = +1 Query: 85 KTGGKGRVKSLPTPVANSPLSPVRQPPKSNI---KPPTRISLPTRTFSANPLER 237 +T + RV++ P A P P PP SN+ PP + P + P ++ Sbjct: 64 ETAARSRVETTDGPAAVIPPPPPPPPPASNVPAPPPPPPVMPPQKVIMRKPTKK 117 >SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) Length = 521 Score = 28.7 bits (61), Expect = 5.7 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 7/79 (8%) Frame = +1 Query: 79 APKTGGKG-RVKSLPTPVANSPLSPVRQPPKSNIKPPTRISLPT------RTFSANPLER 237 +PKT K R+KSL T SP R PK++ K + SL T T L+R Sbjct: 349 SPKTSPKTMRMKSLKTSPKTSPEISPRTSPKTSSKTSPKTSLKTSLNTSLNTSQKTSLKR 408 Query: 238 SISSSM*VKNQSSTEKMDI 294 S++++ S +K+++ Sbjct: 409 SLNTNK--PGDKSKDKLEV 425 >SB_29559| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 858 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 76 DAPKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPPT 189 D +T G+ V P PL+P PPK+ + P+ Sbjct: 300 DPGQTQGEEAVPGTPLQKPGGPLAPAESPPKTGTEEPS 337 >SB_24355| Best HMM Match : SAM_2 (HMM E-Value=3e-07) Length = 352 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 82 PKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPP 186 P+T + KS P P+ +SPV++P K PP Sbjct: 213 PRTNSSNKKKSAP-PLPKHVVSPVKRPNKVKAPPP 246 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 118 PTPVANSPLSPVRQPP---KSNIKPPTRISLPTRTFSANPLE 234 P+P + P P RQPP S PP R P T A+P E Sbjct: 1062 PSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTE 1103 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 82 PKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPP 186 P+T + KS P P+ +SPV++P K PP Sbjct: 213 PRTNSSNKKKSAP-PLPKHVVSPVKRPNKVKAPPP 246 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 118 PTPVANSPLSPVRQPPKSNIKPPTRI-SLPTRTFSANP 228 P P PL P+R+PP PP + S PT + P Sbjct: 36 PIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRP 73 >SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2142 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 112 SLPTPVANSPLSPVRQPPKS 171 SLP P+A+ L P QPPK+ Sbjct: 1496 SLPQPIASKQLEPPPQPPKA 1515 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 133 NSPLSPVRQPPKSNIKPPTRISLPTRTFSA 222 ++PLSP PPKS ++ P + + SA Sbjct: 2161 SNPLSPFHDPPKSPVEEPMQFEQLAKVLSA 2190 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 27.9 bits (59), Expect = 10.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 115 LPTPVANSPLSPVRQPPKSNIKPPTRISLP 204 LPTP+A+S P+ PP PPT I +P Sbjct: 689 LPTPIASSEPLPLPPPP-----PPTGIDIP 713 >SB_17494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 27.9 bits (59), Expect = 10.0 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +3 Query: 564 IIDSKTTRAHGFCMLWFT--SKSRWTILTA*TY--AVKNAIYITTFQRPRTKYILPSIWS 731 +I + GF W S + T + Y VK Y T F RTK +L +IW Sbjct: 118 VISDTYCQFQGFTCTWLACVSLATLTFMAVNRYYRIVKPDRYRTVFTAKRTKLLLSAIWG 177 Query: 732 TSAI*P 749 S + P Sbjct: 178 FSLLSP 183 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 85 KTGGKGRVKSLPTPVAN--SPLSPVRQPPKSNIKPPTRISLPTRTFSANPLERSISSS 252 +TG + P PV N SP P+R+ + P R PTRT S S +++ Sbjct: 702 RTGSVNKPSRAPPPVPNHPSPAVPLRREGDTKSFAPQRPPPPTRTPSGKDRPHSTTAT 759 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 27.9 bits (59), Expect = 10.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 620 EKPLDDSDRIDICCQKCYLYHNVPKTSYE 706 E+ + D+D D+ C+ C +Y N P E Sbjct: 307 EQAVGDADENDLLCKTCNMYFNSPHNKRE 335 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,962,522 Number of Sequences: 59808 Number of extensions: 551567 Number of successful extensions: 1807 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1798 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -