BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120432.Seq (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0120 - 18349131-18349880,18349972-18350259,18350383-18350568 30 2.1 02_01_0056 - 419393-420208 28 8.5 >01_05_0120 - 18349131-18349880,18349972-18350259,18350383-18350568 Length = 407 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/48 (22%), Positives = 26/48 (54%) Frame = +2 Query: 56 HLNAALINDASCMENVNLSAYMQDCVKISDALILYCLREGRVQELKLI 199 H++ L+N + ++ + + +C + + L+L ++ G V LKL+ Sbjct: 129 HIDNVLVNGSGTLDGQGAAVWKDECKILPNTLVLDYVKNGTVSGLKLV 176 >02_01_0056 - 419393-420208 Length = 271 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +2 Query: 17 KQYIDYDYVFKYKHLNAALINDASCMENVNLSAYMQDCVKI 139 KQY+ Y + + +A L N+ E +++S ++DC+ I Sbjct: 28 KQYVYYSQLIRSIEHDAELQNEVFHTEKLHISKSVKDCINI 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,407,780 Number of Sequences: 37544 Number of extensions: 400308 Number of successful extensions: 891 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -