BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120428.Seq (758 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.01 ||SPAPB2C8.02|transcription factor |Schizosaccharom... 27 2.9 SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharom... 25 8.9 >SPAPB24D3.01 ||SPAPB2C8.02|transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 594 Score = 27.1 bits (57), Expect = 2.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 164 QKKFRSLPRRYLSALRTFVFVHRLRRNGKRDNTC 265 Q+ F + YLS T +F+HRL + + N C Sbjct: 445 QRLFSACIEVYLSYCNTLIFLHRLNESVEGANIC 478 >SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 25.4 bits (53), Expect = 8.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 224 VHRLRRNGKRDNTCPKCKSG 283 +H + R+ + CPKCK+G Sbjct: 810 LHLVHRDCATETVCPKCKAG 829 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,824,041 Number of Sequences: 5004 Number of extensions: 52870 Number of successful extensions: 134 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -