BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120428.Seq (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0238 - 1576211-1576759,1577315-1577664,1578684-1578816 33 0.19 01_06_0359 + 28722524-28722613,28722794-28722863,28723062-287231... 33 0.33 04_04_1553 - 34363848-34366058,34369087-34370451 31 1.3 03_02_0458 + 8643804-8643904,8643994-8644091,8644206-8644504,864... 29 4.0 07_03_0872 - 22190468-22190575,22190652-22190910,22191005-221911... 28 7.0 06_01_1147 + 9606860-9606989,9607078-9607811,9607890-9608126,960... 28 7.0 12_02_0938 - 24576419-24576719,24576817-24576969,24577052-245778... 28 9.3 12_02_0311 + 17361153-17361282,17361371-17362104,17362183-173626... 28 9.3 12_02_0096 - 13573612-13573632,13573846-13573884,13574160-135744... 28 9.3 12_01_0775 - 7070620-7070920,7071000-7071170,7071253-7072085,707... 28 9.3 12_01_0705 + 6065932-6066061,6066150-6066883,6066962-6067423,606... 28 9.3 11_06_0747 - 26867114-26867225,26868443-26868531,26869342-268693... 28 9.3 11_06_0576 - 25127807-25128107,25128241-25128357,25128730-251292... 28 9.3 11_04_0390 - 17108441-17108654,17108821-17108991,17109074-171091... 28 9.3 11_01_0582 - 4632377-4632677,4632757-4632927,4633010-4633842,463... 28 9.3 10_05_0091 - 9085506-9085758,9085838-9085992,9086091-9086132,908... 28 9.3 10_03_0045 - 7353148-7353448,7353528-7353698,7353781-7354613,735... 28 9.3 09_02_0330 + 7321031-7321231,7321313-7321434,7321461-7322135,732... 28 9.3 08_02_1612 + 28226138-28226267,28226356-28227089,28227168-282276... 28 9.3 08_02_1391 + 26668539-26668668,26668757-26669490,26669569-266700... 28 9.3 08_02_0942 - 22845270-22845570,22845650-22845820,22845903-228467... 28 9.3 08_02_0778 + 21119812-21119941,21120030-21120463,21120576-211206... 28 9.3 08_02_0712 - 20329967-20330267,20330347-20330517,20330600-203314... 28 9.3 08_02_0331 - 15852164-15852464,15852544-15852714,15852797-158536... 28 9.3 08_02_0327 + 15821587-15821716,15821805-15822538,15822617-158230... 28 9.3 08_02_0223 - 14452059-14452359,14452439-14452609,14452692-144532... 28 9.3 08_01_0258 - 2112170-2112470,2112550-2112720,2112803-2113635,211... 28 9.3 07_03_1513 - 27327702-27328604,27329957-27329995,27330413-273306... 28 9.3 07_03_0729 - 21025525-21025825,21025905-21026075,21026158-210269... 28 9.3 07_03_0422 + 18015230-18015359,18015448-18016181,18016260-180167... 28 9.3 07_03_0139 + 14143383-14143512,14143601-14144334,14144413-141448... 28 9.3 07_03_0052 - 12833004-12833057,12833917-12833955,12834231-128346... 28 9.3 07_01_0943 - 7959813-7960113,7960193-7960363,7960446-7961278,796... 28 9.3 07_01_0811 - 6377328-6377628,6377708-6377878,6377961-6378145,637... 28 9.3 06_03_0463 - 21038166-21038466,21038546-21038716,21038799-210396... 28 9.3 06_03_0262 + 18905352-18905481,18905570-18906003,18906082-189063... 28 9.3 06_03_0249 + 18700299-18700769,18700848-18701309,18701391-187022... 28 9.3 06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121,963... 28 9.3 06_01_1107 + 9120664-9120793,9120882-9121615,9121694-9123069,912... 28 9.3 05_07_0218 + 28470325-28470454,28470543-28471276,28471355-284718... 28 9.3 05_07_0085 - 27591909-27592152,27592232-27592402,27592485-275926... 28 9.3 05_05_0143 + 22675463-22675592,22676227-22676414,22676492-226766... 28 9.3 05_03_0464 + 14350391-14350520,14350609-14351342,14351421-143518... 28 9.3 05_03_0399 + 13517874-13518003,13518092-13518825,13518904-135193... 28 9.3 04_04_0899 - 29229812-29229929,29230009-29230179,29230262-292310... 28 9.3 04_04_0067 + 22498987-22499116,22499205-22499938,22500017-225004... 28 9.3 04_03_0574 - 17338777-17339077,17339390-17340222,17340304-173407... 28 9.3 04_03_0421 - 15725045-15725193,15725528-15725599,15725709-157257... 28 9.3 04_03_0412 - 15595781-15596081,15596161-15596331,15596414-155972... 28 9.3 04_03_0262 + 13597021-13597150,13597239-13597972,13598051-135985... 28 9.3 04_02_0023 + 8655524-8655653,8655742-8656475,8656553-8656918,865... 28 9.3 04_01_0606 - 7949609-7949822,7949989-7950159,7950242-7951074,795... 28 9.3 04_01_0224 - 2830669-2830969,2831049-2831219,2831302-2832134,283... 28 9.3 04_01_0118 - 1223530-1223830,1223910-1224080,1224163-1224995,122... 28 9.3 04_01_0048 + 522423-522552,522641-523374,523453-524828,528100-52... 28 9.3 03_06_0623 + 35160081-35160210,35160299-35161032,35161111-351615... 28 9.3 02_05_0268 - 27302734-27303034,27303114-27303284,27303367-273041... 28 9.3 02_04_0153 - 20330775-20330831,20330913-20330999,20333119-203331... 28 9.3 02_03_0337 + 17898732-17899370,17899516-17899977,17900058-179006... 28 9.3 02_01_0601 + 4465775-4465924,4466070-4466531,4466613-4467445,446... 28 9.3 01_03_0214 + 13863123-13863593,13863671-13864132,13864308-138650... 28 9.3 01_03_0195 - 13674138-13674438,13674518-13674688,13674771-136756... 28 9.3 01_02_0132 + 11444480-11444609,11444698-11445131,11445210-114454... 28 9.3 >02_01_0238 - 1576211-1576759,1577315-1577664,1578684-1578816 Length = 343 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 150 ACMRCRRSFAVYPAVTYLHCGHSCLCTDCDETVNV 254 AC CR A AV + C H CLC DC++ +V Sbjct: 295 ACRLCRMKEA---AVLVMPCRHLCLCADCEKNADV 326 >01_06_0359 + 28722524-28722613,28722794-28722863,28723062-28723159, 28724029-28724167,28724243-28724370,28724500-28724592, 28724707-28724757,28725405-28725470,28725568-28725633, 28725900-28725977,28726248-28726427,28726502-28726577, 28726660-28726823,28727569-28727931 Length = 553 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 149 CMHALQKKFRSLPRRYLSALRTFVFVHRLRRNG 247 C+HAL ++ R ++ AL+T V +HRL R+G Sbjct: 71 CIHALARRLAKT-RNWIVALKTLVVIHRLLRDG 102 >04_04_1553 - 34363848-34366058,34369087-34370451 Length = 1191 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 150 ACMRCRRSFAVYPAVTYLHCGHSCLCTDCD 239 +C RC R V+ V ++H GHS +C D Sbjct: 473 SCCRCIRFLHVFVFVLHIHGGHSQMCDPAD 502 >03_02_0458 + 8643804-8643904,8643994-8644091,8644206-8644504, 8645930-8646460 Length = 342 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 105 NLPLNTECNVKAVD-SACMRCRRSFAVYPAVTYLHCGHSCLCTDCDETVN 251 NL L + N + D +AC C+ S A + L C H CLC +C+ ++ Sbjct: 279 NLQLMPKENRHSKDLTACRVCKSSEA---CMLLLPCRHLCLCKECESKLS 325 >07_03_0872 - 22190468-22190575,22190652-22190910,22191005-22191108, 22191245-22191423,22191565-22191670,22191797-22191940, 22192024-22192179,22192274-22192378,22192483-22192545, 22192993-22192995 Length = 408 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = +3 Query: 351 VYLSPAQILNLNLPLAYQKSVL-----FASNSAKVNERIRRLAR 467 VYL P + L YQ VL FA + AK+N R+R LAR Sbjct: 53 VYLFPNYHPTRMITLVYQPFVLTTTALFAYHEAKINTRMRNLAR 96 >06_01_1147 + 9606860-9606989,9607078-9607811,9607890-9608126, 9608433-9609265,9609598-9609856,9610294-9610377, 9610484-9610498 Length = 763 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 444 FIQWPKEDIVVKMTPCPSRPTELTP 468 >12_02_0938 - 24576419-24576719,24576817-24576969,24577052-24577884, 24577966-24578427,24578506-24579213 Length = 818 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 467 FIQWPKEDIVVKMTPRPSRPTELTP 491 >12_02_0311 + 17361153-17361282,17361371-17362104,17362183-17362644, 17362726-17363558,17363641-17363811,17363891-17364191 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >12_02_0096 - 13573612-13573632,13573846-13573884,13574160-13574493, 13574660-13574830,13574913-13575730,13575812-13576114, 13576352-13577085,13577174-13577303 Length = 849 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 461 FIQWPKEDIVVKMTPRPSRPTELTP 485 >12_01_0775 - 7070620-7070920,7071000-7071170,7071253-7072085, 7072167-7072628,7072707-7073440,7073529-7073658 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >12_01_0705 + 6065932-6066061,6066150-6066883,6066962-6067423, 6067505-6068337,6068420-6068590,6068670-6068919, 6069367-6069405,6069598-6069672 Length = 897 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >11_06_0747 - 26867114-26867225,26868443-26868531,26869342-26869380, 26869819-26870077,26870157-26870327,26870410-26870451, 26870896-26871242,26871324-26871785,26871864-26872597, 26872686-26872815 Length = 794 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >11_06_0576 - 25127807-25128107,25128241-25128357,25128730-25129271, 25129353-25129814,25129893-25130626,25130715-25130742 Length = 727 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 485 FIQWPKEDIVVKMTPRPSRPTELTP 509 >11_04_0390 - 17108441-17108654,17108821-17108991,17109074-17109115, 17109364-17109905,17109987-17110448,17110527-17111260, 17111349-17111478 Length = 764 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >11_01_0582 - 4632377-4632677,4632757-4632927,4633010-4633842, 4633924-4634385,4634464-4635197,4635286-4635415 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >10_05_0091 - 9085506-9085758,9085838-9085992,9086091-9086132, 9086379-9086921,9087003-9087287,9087332-9087463, 9087542-9087729,9088186-9088240 Length = 550 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 297 FIQWPKEDIVVKMTPRPSRPTELTP 321 >10_03_0045 - 7353148-7353448,7353528-7353698,7353781-7354613, 7354695-7355156,7355235-7355968,7356057-7356186 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >09_02_0330 + 7321031-7321231,7321313-7321434,7321461-7322135, 7322218-7322287,7322469-7322768 Length = 455 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 135 FIQWPKEDIVVKMTPRPSRPTELTP 159 >08_02_1612 + 28226138-28226267,28226356-28227089,28227168-28227629, 28227711-28228543,28228626-28228796,28228876-28229176 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_1391 + 26668539-26668668,26668757-26669490,26669569-26670030, 26670112-26670944,26671364-26671577 Length = 790 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0942 - 22845270-22845570,22845650-22845820,22845903-22846735, 22846817-22847278,22847357-22848090,22848179-22848308 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0778 + 21119812-21119941,21120030-21120463,21120576-21120695, 21121356-21121898,21121988-21122172,21122255-21122425, 21122505-21122805 Length = 627 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 305 FIQWPKEDIVVKMTPRPSRPTELTP 329 >08_02_0712 - 20329967-20330267,20330347-20330517,20330600-20331432, 20331514-20331975,20332054-20332787,20332876-20333005 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0331 - 15852164-15852464,15852544-15852714,15852797-15853629, 15853711-15854172,15854251-15854984,15855073-15855202 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0327 + 15821587-15821716,15821805-15822538,15822617-15823078, 15823160-15823992,15824075-15824245,15824325-15824625 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >08_02_0223 - 14452059-14452359,14452439-14452609,14452692-14453299, 14453393-14453524,14453606-14454067,14454146-14454979 Length = 835 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 478 FIQWPKEDIVVKMTPRPSRPTELTP 502 >08_01_0258 - 2112170-2112470,2112550-2112720,2112803-2113635, 2113717-2114178,2114257-2114990,2115079-2115208 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_1513 - 27327702-27328604,27329957-27329995,27330413-27330692, 27330772-27330942,27331025-27331857,27331939-27332400, 27332479-27333212,27333301-27333430 Length = 1183 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0729 - 21025525-21025825,21025905-21026075,21026158-21026990, 21027072-21027533,21027612-21028345,21028434-21028563 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0422 + 18015230-18015359,18015448-18016181,18016260-18016721, 18016803-18017635,18017718-18017888,18017968-18018268 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0139 + 14143383-14143512,14143601-14144334,14144413-14144874, 14144956-14145788,14145871-14146041,14146121-14146379, 14146828-14146866,14147903-14147989 Length = 904 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >07_03_0052 - 12833004-12833057,12833917-12833955,12834231-12834651, 12834731-12834901,12834984-12835816,12835898-12836359, 12836438-12837171,12837260-12837389 Length = 947 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >07_01_0943 - 7959813-7960113,7960193-7960363,7960446-7961278, 7961360-7961821,7961899-7962606 Length = 824 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 467 FIQWPKEDIVVKMTPRPSRPTELTP 491 >07_01_0811 - 6377328-6377628,6377708-6377878,6377961-6378145, 6378255-6378797,6378879-6379304,6379383-6380116, 6380205-6380334 Length = 829 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 507 FIQWPKEDIVVKMTPRPSRPTELTP 531 >06_03_0463 - 21038166-21038466,21038546-21038716,21038799-21039631, 21039713-21040174,21040253-21040986,21041075-21041204 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >06_03_0262 + 18905352-18905481,18905570-18906003,18906082-18906303, 18906381-18906842,18906935-18907755,18907838-18908008, 18908088-18908347,18908453-18908508,18908786-18908824, 18909711-18909764 Length = 882 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 489 FIQWPKEDIVVKMTPRPSRPTELTP 513 >06_03_0249 + 18700299-18700769,18700848-18701309,18701391-18702223, 18702306-18702476,18702556-18702856 Length = 745 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 388 FIQWPKEDIVVKMTPRPSRPTELTP 412 >06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121, 9631203-9632035,9632118-9632288,9632368-9632668 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >06_01_1107 + 9120664-9120793,9120882-9121615,9121694-9123069, 9123152-9123322,9123402-9123702 Length = 903 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 546 FIQWPKEDIVVKMTPRPSRPTELTP 570 >05_07_0218 + 28470325-28470454,28470543-28471276,28471355-28471816, 28471898-28472730,28472813-28472983,28473063-28473180 Length = 815 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >05_07_0085 - 27591909-27592152,27592232-27592402,27592485-27592648, 27592775-27593317,27593399-27593860,27593939-27594672, 27594761-27594890 Length = 815 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >05_05_0143 + 22675463-22675592,22676227-22676414,22676492-22676649, 22676656-22676953,22677035-22677867,22677950-22678120, 22678242-22678458,22678911-22678949,22679167-22679226 Length = 697 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 335 FIQWPKEDIIVKMTPRPSRPTELTP 359 >05_03_0464 + 14350391-14350520,14350609-14351342,14351421-14351882, 14351964-14352796,14352879-14352948,14352964-14353049, 14353129-14353429 Length = 871 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >05_03_0399 + 13517874-13518003,13518092-13518825,13518904-13519365, 13519447-13520279,13520362-13520532,13520612-13520912 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >04_04_0899 - 29229812-29229929,29230009-29230179,29230262-29231094, 29231176-29231637,29231716-29232186 Length = 684 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 388 FIQWPKEDIVVKMTPRPSRPTELTP 412 >04_04_0067 + 22498987-22499116,22499205-22499938,22500017-22500478, 22500560-22501392,22501475-22501645,22501725-22502025 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >04_03_0574 - 17338777-17339077,17339390-17340222,17340304-17340765, 17340843-17341030,17341244-17341576,17341665-17341796, 17342604-17342643 Length = 762 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 462 FIQWPKEDIVVKMTPRPSRPTELTP 486 >04_03_0421 - 15725045-15725193,15725528-15725599,15725709-15725784, 15728607-15728679,15728919-15728983,15729423-15729681, 15729761-15729931,15730014-15730846,15731097-15731390, 15731469-15731939 Length = 820 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 332 FIQWPKEDIVVKMTPRPSRPTELTP 356 >04_03_0412 - 15595781-15596081,15596161-15596331,15596414-15597246, 15597369-15597788,15597867-15598337 Length = 731 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 374 FIQWPKEDIVVKMTPRPSRPTELTP 398 >04_03_0262 + 13597021-13597150,13597239-13597972,13598051-13598512, 13598594-13599136,13599385-13599426,13599594-13599679, 13599759-13600017,13600456-13600494,13603624-13603737 Length = 802 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >04_02_0023 + 8655524-8655653,8655742-8656475,8656553-8656918, 8657062-8657183,8657210-8657786 Length = 642 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 478 FIQWPKEDIVVKMTPRPSRPTELTP 502 >04_01_0606 - 7949609-7949822,7949989-7950159,7950242-7951074, 7951156-7951476,7951696-7952166 Length = 669 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 341 FIQWPKEDIVVKMTPRPSRPTELTP 365 >04_01_0224 - 2830669-2830969,2831049-2831219,2831302-2832134, 2832216-2832677,2832756-2833489,2833578-2833707 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >04_01_0118 - 1223530-1223830,1223910-1224080,1224163-1224995, 1225077-1225538,1225617-1226350,1226439-1226568 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >04_01_0048 + 522423-522552,522641-523374,523453-524828,528100-528400 Length = 846 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 546 FIQWPKEDIVVKMTPRPSRPTELTP 570 >03_06_0623 + 35160081-35160210,35160299-35161032,35161111-35161572, 35161654-35162486,35162569-35162739,35162819-35163119 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >02_05_0268 - 27302734-27303034,27303114-27303284,27303367-27304199, 27304281-27304742,27304821-27305554,27305643-27305772 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >02_04_0153 - 20330775-20330831,20330913-20330999,20333119-20333157, 20333596-20333754,20334035-20334104,20334187-20335035, 20335270-20335562,20335640-20336347 Length = 753 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 416 FIQWPKEDIVVKMTPRPSRPTELTP 440 >02_03_0337 + 17898732-17899370,17899516-17899977,17900058-17900688, 17900819-17900888,17900971-17901141,17901221-17901479, 17901918-17901956,17902900-17902914 Length = 761 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 444 FIQWPKEDIVVKMTPRPSRPTELTP 468 >02_01_0601 + 4465775-4465924,4466070-4466531,4466613-4467445, 4467528-4467597,4467613-4467698,4467865-4468036, 4468481-4468519,4469410-4469430 Length = 610 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 281 FIQWPKEDIVVKMTPRPSRPTELTP 305 >01_03_0214 + 13863123-13863593,13863671-13864132,13864308-13865038, 13865121-13865291,13865371-13865629,13866069-13866158 Length = 727 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 356 FIQWPKEDIVVKMTPRPSRPTELTP 380 >01_03_0195 - 13674138-13674438,13674518-13674688,13674771-13675603, 13675685-13676146,13676225-13676958,13677047-13677176 Length = 876 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 519 FIQWPKEDIVVKMTPRPSRPTELTP 543 >01_02_0132 + 11444480-11444609,11444698-11445131,11445210-11445431, 11445510-11445971,11446053-11446885,11446968-11447138, 11447218-11447518 Length = 850 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 408 FFGMPKEDLNLKSAPATSKPTRKSP 334 F PKED+ +K P S+PT +P Sbjct: 493 FIQWPKEDIVVKMTPRPSRPTELTP 517 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,656,640 Number of Sequences: 37544 Number of extensions: 351025 Number of successful extensions: 1042 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -