Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120426.Seq
         (700 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    25   0.91 
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    21   8.5  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    21   8.5  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    21   8.5  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    21   8.5  

>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 24.6 bits (51), Expect = 0.91
 Identities = 14/40 (35%), Positives = 17/40 (42%)
 Frame = +3

Query: 432 MAATGDGNSRSVSAVGTHKGAERRPCEKLRPNMSVYGTVQ 551
           MAA G G +RS   +         P   L+P   VYG  Q
Sbjct: 75  MAAAGKGAARSDDWLANANSPVGSPSAALQPQHVVYGNPQ 114


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +1

Query: 397 VVTTFHRVGENEWLLPVTGIQEASRLSGHIKVPNGVR 507
           V  TF    +N +L  VT   +  RLSG   V  G+R
Sbjct: 118 VPDTFFANDKNSFLHDVTERNKLVRLSGDGSVTYGMR 154


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +2

Query: 524 QHVCLRDCAIAVR 562
           +H C+ DC + VR
Sbjct: 340 EHPCVMDCKVGVR 352


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +2

Query: 524 QHVCLRDCAIAVR 562
           +H C+ DC + VR
Sbjct: 255 EHPCVMDCKVGVR 267


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +2

Query: 524 QHVCLRDCAIAVR 562
           +H C+ DC + VR
Sbjct: 574 EHPCVMDCKVGVR 586


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,474
Number of Sequences: 438
Number of extensions: 4135
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)