BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120421.Seq (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67500.1 68414.m07688 DNA polymerase family B protein similar... 28 7.9 >At1g67500.1 68414.m07688 DNA polymerase family B protein similar to SP|Q61493 DNA polymerase zeta catalytic subunit (EC 2.7.7.7) {Mus musculus}; contains Pfam profile PF00136: DNA polymerase family B Length = 1890 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 129 SPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVPGFCA*MAFTNLVDTL 284 S S +RHQ + S + G + DI NQQ ++ + TN+V +L Sbjct: 261 SQSQHRHQHHYRRQSLCELEGDATSSDILNQQFKMYNSLSQAQSDTNMVQSL 312 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,352,829 Number of Sequences: 28952 Number of extensions: 302217 Number of successful extensions: 629 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -