BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120419.Seq (789 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 25 0.52 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.9 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 8.5 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 25.4 bits (53), Expect = 0.52 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +3 Query: 285 LQATRARVEIFASFSILSKPFAERLLLYSKFG*ILVRIKTQYFP 416 LQ R R E+ ++L K R ++V + T YFP Sbjct: 234 LQCGRVRSEVVKILNVLKKIALRRQTTNGDLDELIVTLSTHYFP 277 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 101 WGLRRL*VLKPGLINTTTAYDKKKINKKESVL 6 WG R + V+ N ++KK KK+ VL Sbjct: 1032 WGTREVTVVPKPDPNAVQKIEEKKPEKKDKVL 1063 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 101 WGLRRL*VLKPGLINTTTAYDKKKINKKESVL 6 WG R + V+ N ++KK KK+ VL Sbjct: 1032 WGTREVTVVPKPDPNAVQKIEEKKPEKKDKVL 1063 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 202 CITTDVYCVRAGHNDGEATNL 264 CIT YC +G N T++ Sbjct: 247 CITQFYYCYDSGFNSDNLTDV 267 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,724 Number of Sequences: 336 Number of extensions: 3881 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -