BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120419.Seq (789 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 9.9 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = -3 Query: 427 FSFSGKY*VFILTRIYPNFEYSRSLSAKGLESMLNDAKISTLALVAWRPSVMLAGD---S 257 F F +Y + + + P F+ +SLS + S++ND ++ L + A + + + S Sbjct: 356 FQFLVRYRISSYSSVEPWFKKLKSLSIFDVTSVVNDVYMTPLNVTAVNHTATASANLSVS 415 Query: 256 WLPRHCVQPLH 224 WLP + +H Sbjct: 416 WLPDQSRELVH 426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,341,772 Number of Sequences: 59808 Number of extensions: 454420 Number of successful extensions: 869 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 869 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -