BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120418.Seq (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 31 0.73 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.0 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 3.9 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 6.8 At3g62370.1 68416.m07006 expressed protein 28 6.8 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 28 6.8 At4g29310.1 68417.m04190 expressed protein 27 9.0 At3g47910.1 68416.m05224 expressed protein low similarity to non... 27 9.0 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -2 Query: 149 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 3 LG +H PA +I+R P PP +S +++++F E +CY S V Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVV 277 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 288 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 401 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 252 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 136 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 113 DRAPLPPNRVSNETMKVVVFQRRSRET 33 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 237 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 142 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -2 Query: 164 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 27 S LC LG+ R PAD I+ L R+ M +V R S + I+ Sbjct: 54 SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -3 Query: 496 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 335 I G K ++ ++ + + + CG SG K+ + D A LS+++ N W K Sbjct: 85 ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138 >At3g47910.1 68416.m05224 expressed protein low similarity to nonmuscle myosin heavy chain (NMHC) [Homo sapiens] GI:189036; contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1290 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 152 TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 57 T+G+ HR+ AD ++ +PLP V + + +V Sbjct: 972 TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,996,895 Number of Sequences: 28952 Number of extensions: 346458 Number of successful extensions: 866 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -