BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120417.Seq (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 0.92 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 8.6 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 8.6 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 8.6 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.2 bits (50), Expect = 0.92 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 68 RRDAETARQDCENARRETAQLANRMAD 148 RR+ E A++D + + T + N +AD Sbjct: 91 RREVEKAKRDLSSVHKTTLTIENLLAD 117 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 331 NVLNKVKEAIPRNKFKAKHNRITLLEDYTREELMNVIGSTMTDRQ 465 NVL E P K H +++ + R +MN+I +T Q Sbjct: 115 NVLLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEITTHQ 159 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 331 NVLNKVKEAIPRNKFKAKHNRITLLEDYTREELMNVIGSTMTDRQ 465 NVL E P K H +++ + R +MN+I +T Q Sbjct: 115 NVLLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEITTHQ 159 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 331 NVLNKVKEAIPRNKFKAKHNRITLLEDYTREELMNVIGSTMTDRQ 465 NVL E P K H +++ + R +MN+I +T Q Sbjct: 115 NVLLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEITTHQ 159 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,669 Number of Sequences: 336 Number of extensions: 2521 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -