BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120416X.Seq (536 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0481 - 29646245-29646371,29646474-29646556,29646672-296467... 29 1.8 12_01_0624 - 5137096-5137310,5137923-5138380,5138428-5140070,514... 29 2.3 03_06_0170 - 32128619-32129647 29 2.3 03_06_0163 - 32105234-32105977 29 2.3 07_03_1424 - 26474464-26474514,26474549-26474635,26474905-264750... 28 4.1 03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247... 28 4.1 01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 28 4.1 12_02_0399 - 18600444-18600591,18600626-18601656 28 5.4 10_08_0860 - 21136509-21136997 28 5.4 04_01_0301 + 4016588-4016627,4016715-4018837 28 5.4 12_02_0757 + 22845825-22846032,22848331-22848498,22848929-228494... 27 7.2 07_01_1177 + 11125945-11126242,11126465-11128303,11128342-11128358 27 7.2 04_03_0594 - 17733827-17735085,17735576-17735642,17736379-177364... 27 7.2 02_05_0417 - 28796121-28796743,28796829-28796925,28797010-287970... 27 7.2 05_02_0044 + 5968289-5968448,5968551-5968687 27 9.5 04_04_0085 + 22624918-22625035,22625225-22625421,22625460-22625597 27 9.5 >01_06_0481 - 29646245-29646371,29646474-29646556,29646672-29646752, 29646843-29646899,29647007-29647094,29647304-29647374, 29647457-29647585,29647662-29648051,29648332-29648517, 29648612-29648692,29648787-29648879,29648966-29649086, 29649200-29649409,29649560-29649727,29649898-29650065, 29650144-29650311,29650453-29650620,29650738-29650905, 29651023-29651190,29651567-29651734,29652391-29652558, 29652645-29652812,29655720-29655887,29656069-29656236, 29656391-29656558,29656670-29656837,29657525-29657664, 29658033-29658221,29658243-29658315,29658379-29658452, 29658535-29658654,29658718-29658738,29658794-29658999, 29659094-29659271,29660066-29660126,29660232-29660341, 29660427-29660558,29661091-29661258,29661339-29661465, 29661794-29661831,29663321-29663422,29663505-29663562, 29663659-29663760,29663844-29663990,29664098-29664234, 29664313-29664462,29664561-29664720,29665820-29665878, 29666025-29666181,29666288-29666433,29666523-29666666, 29667242-29667376 Length = 2344 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = -2 Query: 247 KTEELFKKQEFIERIIAIKDKQIEAKDLQVTRVMTDLNRMYTGFQETMQRKDEMMHK 77 K E+ KK E ++ I + IEAKD+ + + + + E ++ +E++ K Sbjct: 1700 KIEDTDKKIEHLQNAIIKLEGDIEAKDISLEAAREENDTIRKSLAEAQEKNEELLRK 1756 >12_01_0624 - 5137096-5137310,5137923-5138380,5138428-5140070, 5140245-5140462,5140589-5140757,5141249-5141305 Length = 919 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = -3 Query: 402 EWLLEEVIPHVLCTGKY-DPAIKQQEEKNKQLVTKLIATFTEHTNALQAVGRKKPRNFLK 226 EW +V+ H GK +P +E N+ ++ LI ++ VGR ++ K Sbjct: 67 EWGKYQVL-HGFVNGKSNEPEELGKEYYNELIIRNLIQAMPNSEWSMHDVGRSFCQHLAK 125 Query: 225 SKSLSNASSQLRTS 184 ++LS+ QLR S Sbjct: 126 DEALSSQMGQLRVS 139 >03_06_0170 - 32128619-32129647 Length = 342 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 467 ISTVCGCKYSGSPCLPRCL 523 +ST C C+ SG P LP C+ Sbjct: 88 LSTRCSCQLSGKPSLPGCI 106 >03_06_0163 - 32105234-32105977 Length = 247 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 467 ISTVCGCKYSGSPCLPRCL 523 +ST C C+ SG P LP C+ Sbjct: 83 LSTRCSCQLSGKPSLPGCI 101 >07_03_1424 - 26474464-26474514,26474549-26474635,26474905-26475006, 26475149-26475260,26475405-26475463,26475559-26475633, 26475734-26475832,26476128-26476343,26476426-26476500, 26476583-26476670,26476757-26476902,26477240-26477347, 26477417-26478436,26478437-26478715,26479471-26480520, 26480636-26480692,26480780-26480837,26481379-26481458, 26481598-26481654,26481764-26481833,26481967-26482202, 26482341-26482445,26482534-26482680,26482758-26482823, 26482916-26482979,26484040-26484200,26484308-26484400, 26484487-26484600,26484684-26484803,26484893-26484976, 26485061-26485216,26485389-26485811 Length = 1885 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/44 (25%), Positives = 28/44 (63%) Frame = -2 Query: 163 QVTRVMTDLNRMYTGFQETMQRKDEMMHKKDELLQVKDTQVSNL 32 +++ V + +MY + ++ R++E++H ++LLQ + T + +L Sbjct: 797 EISLVKENAEKMYGHDEISVYRQNEILHSSEQLLQDELTHIKSL 840 >03_06_0337 + 33224333-33224479,33224603-33224663,33224740-33224776, 33225237-33225367,33225447-33225590,33225686-33225776, 33225973-33226106,33226234-33226373,33227328-33227426, 33227520-33227602,33227690-33227744,33227826-33227937, 33228274-33228766,33228881-33229094,33229203-33229273, 33229733-33229901,33229991-33230120,33230556-33230968, 33231059-33231262 Length = 975 Score = 28.3 bits (60), Expect = 4.1 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Frame = -2 Query: 271 RAASGGAQKTEELFKKQEFIERIIAIKDKQIEAKDLQVTRVMTDLNRMYTGFQETMQRKD 92 + A+ A E L KK+ ++ A D EAKD T D N + + + Sbjct: 108 KLATHRAPLKERLQKKENAVQAKDA--DATNEAKDADATNEAKDANATNEAYATSTAKHK 165 Query: 91 EMMHKKD-ELLQV--KDTQVSNLIA 26 E HK D E LQ+ K+T +S ++ Sbjct: 166 ETSHKTDTEPLQLLKKETTLSKEVS 190 >01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 Length = 5436 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/59 (25%), Positives = 33/59 (55%) Frame = -2 Query: 211 ERIIAIKDKQIEAKDLQVTRVMTDLNRMYTGFQETMQRKDEMMHKKDELLQVKDTQVSN 35 E I+++ + IE K + ++L ++YTG ++ +K+E + D++ +KD + N Sbjct: 498 ENSISLQVETIEDKTNFMPEKFSELEKVYTGCEKLNNKKEE-QEENDKINTLKDEKDHN 555 >12_02_0399 - 18600444-18600591,18600626-18601656 Length = 392 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -1 Query: 263 KRWGAKNRGTF*KARVYRTHHRN*GQAD*GQRLASDARDDRPQPHVH 123 K W AK + + V H R+ G Q+L D +D P P +H Sbjct: 332 KAWRAKQKALEMRPNVCVLHDRHAGLLSAIQKLQEDVTEDVPWPDLH 378 >10_08_0860 - 21136509-21136997 Length = 162 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +2 Query: 392 KSHSCNSMAYGSLLFIIN*ITPDLVISTVCGCKYSGSPCLPRCLEP 529 K+ S N +A +++ +++ + S CG + +G C RC +P Sbjct: 6 KNSSRNKLAVAAIVALMSLLVFAAAPSEACGGRCNGGACRSRCAKP 51 >04_01_0301 + 4016588-4016627,4016715-4018837 Length = 720 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 214 IERIIAIKDKQIEAK--DLQVTRVMTDLNRMYTGFQETMQRKDEMMHKKDELL 62 +E ++ + K+ AK + Q +M +L + F+E KD + K DELL Sbjct: 163 MELVVLTEAKKAAAKACEAQNDEIMKELEDLKRKFEELQTNKDLVQAKNDELL 215 >12_02_0757 + 22845825-22846032,22848331-22848498,22848929-22849434, 22849890-22850151,22851708-22851942,22854240-22854496, 22854592-22854635 Length = 559 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 254 PTACSAFVCSVNVAISLVTNCLFF 325 PT+C FV S N++++ ++ LFF Sbjct: 53 PTSCRLFVVSSNISLAFMSCLLFF 76 >07_01_1177 + 11125945-11126242,11126465-11128303,11128342-11128358 Length = 717 Score = 27.5 bits (58), Expect = 7.2 Identities = 23/84 (27%), Positives = 38/84 (45%) Frame = -2 Query: 418 RHRITRMAFRRSHSSRAMHGQVRPRN*TTGGKEQTVGD*TDCDIYRAHKRAASGGAQKTE 239 R ++ M + SS+ QVR R +++T D D D ++ R+ S G + + Sbjct: 109 REKMKDMVQSDASSSKGEALQVRGRF-----EQKTYNDSNDRDKSQSRGRSKSRGKKFCK 163 Query: 238 ELFKKQEFIERIIAIKDKQIEAKD 167 KK FIE ++DK+ D Sbjct: 164 YCKKKNHFIEECWKVQDKEKRKSD 187 >04_03_0594 - 17733827-17735085,17735576-17735642,17736379-17736413, 17736810-17737665 Length = 738 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 27 AIKLETCVSLTCNNSSFLCIISSFLCIVS*N-PVYM 131 AI TC N+ S++CI S+ +C+ S N P Y+ Sbjct: 230 AIGNSTCEQAKTNSDSYMCISSNSVCLNSRNGPGYI 265 >02_05_0417 - 28796121-28796743,28796829-28796925,28797010-28797093, 28797173-28797234,28797316-28797460,28797542-28797961, 28798041-28798090,28798163-28798349,28798426-28798680, 28798785-28798953,28799044-28799177,28799291-28799446, 28799534-28799719,28799798-28799962,28800074-28800190, 28800553-28800762,28800850-28801049,28801135-28801405, 28801481-28801547,28801644-28801942,28802425-28802991 Length = 1487 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 277 HKRAASGGAQKT-EELFKKQEFIERIIAIKDKQI 179 H AA GG KT EE+++K+ +E I+ D I Sbjct: 16 HNAAAGGGGGKTIEEMYQKKTQLEHILLRPDTYI 49 >05_02_0044 + 5968289-5968448,5968551-5968687 Length = 98 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 460 IGRDSIDYEEQASVRHRITRMAFRRSHSSRAMHGQ 356 +GRD +D E +++ R +RSHS +M+GQ Sbjct: 25 LGRDVLDLPEDSNISKR----HIKRSHSGSSMNGQ 55 >04_04_0085 + 22624918-22625035,22625225-22625421,22625460-22625597 Length = 150 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 265 ASGGAQKTEELFKKQEFIERIIAIKDKQIE 176 A GG + T EL ++Q F+ER+ + ++ E Sbjct: 109 ALGGGRATLELAQRQAFVERVFHVAEEDNE 138 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,854,376 Number of Sequences: 37544 Number of extensions: 262332 Number of successful extensions: 700 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -