BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120415.Seq (797 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizo... 30 0.33 SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb... 29 0.77 SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schiz... 28 1.8 SPBC1778.06c |fim1||fimbrin|Schizosaccharomyces pombe|chr 2|||Ma... 28 1.8 SPBC1709.20 |pop8||RNase P and RNase MRP subunit Pop8 |Schizosac... 27 4.1 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 27 4.1 SPCC777.13 |vps35||retromer complex subunit Vps35|Schizosaccharo... 27 4.1 SPAC5H10.06c |adh4||alcohol dehydrogenase Adh4|Schizosaccharomyc... 26 5.4 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 26 5.4 SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase s... 26 5.4 SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces... 25 9.5 SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc... 25 9.5 SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy... 25 9.5 >SPAC29B12.01 |ino80|SPAC3G6.12|SNF2 family helicase Ino80|Schizosaccharomyces pombe|chr 1|||Manual Length = 1604 Score = 30.3 bits (65), Expect = 0.33 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = +2 Query: 14 ERGNFYYNTPPPPLRY--PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSV 187 +RGN + +PPPPL Y P AT NA NNA TT N + ++ ++ + Sbjct: 55 QRGNEFQASPPPPLGYVTPEYGATGTPVNA---NNASRVDYATTAANVPEEYANDYSSEL 111 Query: 188 AIAPYNKSKEPTLD 229 A +N + P +D Sbjct: 112 AYI-HNVNDMPHVD 124 >SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 29.1 bits (62), Expect = 0.77 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 1/87 (1%) Frame = +2 Query: 68 NPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE-PTLDAGESI 244 +P T + + P V DN M T NK LDA ES Sbjct: 418 DPETNLIAGLAPLKDTPVMVMGVESDNLMPVECQRETARCLEKAGNKQVVYHELDANESF 477 Query: 245 WYNNVWILFKKLLDITGAMTCQNLVLS 325 + ++ +++++K LD+ G + L LS Sbjct: 478 YGHDTFLIYRKDLDLVGGKLKKFLELS 504 >SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1253 Score = 27.9 bits (59), Expect = 1.8 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +1 Query: 148 QNGHEPQQQHKLGSDRTV-QQEQRTDARRRRIYLVQQCVDFVQKIIR-YYRCNDMSELSP 321 +N +++ G TV ++E ++ RR I V++ V +++ RCN ++ S Sbjct: 1141 KNNRRLERKRARGKKGTVFEEEYLVNSLRRLIARVEEIRPEVHRLLEALVRCNMTTQASE 1200 Query: 322 LMIHFINTIRDMCIDTNPINVNVVKRFES 408 L +F N I + PI V FE+ Sbjct: 1201 LQRNFANVIGTIGEKVIPILSVPVSTFET 1229 >SPBC1778.06c |fim1||fimbrin|Schizosaccharomyces pombe|chr 2|||Manual Length = 614 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 417 HDTPPDSVAKRVGTRQRGRVPAERFEYI-SGMFVLNSLPA 533 +D+ PD++ +RV +QR P + F+ I + V+NS A Sbjct: 160 NDSVPDTIDERVLNKQRNNKPLDNFKCIENNNVVINSAKA 199 >SPBC1709.20 |pop8||RNase P and RNase MRP subunit Pop8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 108 Score = 26.6 bits (56), Expect = 4.1 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +1 Query: 403 ESEETMIRHLIRLQKELGQGNAAESLPSDSNIFQACLC*IRCRRTRKNFTTVALICWVK 579 E ++ +RHLI L G ++P D Q+ +RC + K VAL +V+ Sbjct: 27 EIDDISLRHLITLALNQSFGIFGSAIPIDFLHRQSKFLYLRCHKEDKKKVLVALGSYVR 85 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +2 Query: 626 HGGGIGDVQHSHSVTVQSAAGQQLHD--SVAQARHSAAKH 739 H I D + +VT+ S++GQ H S H+ H Sbjct: 3688 HSSSISDTKSPATVTISSSSGQFTHSTFSTGSTMHNTVSH 3727 >SPCC777.13 |vps35||retromer complex subunit Vps35|Schizosaccharomyces pombe|chr 3|||Manual Length = 785 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 244 LVQQCVDFVQKIIRYYRCNDMSELSPLMIHFINT 345 +V +C+ F+ + R ++C D +E L+ F+NT Sbjct: 508 VVNRCI-FLARNFRIFKCMDWAEKVRLLWEFVNT 540 >SPAC5H10.06c |adh4||alcohol dehydrogenase Adh4|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 546 FYNGGADMLGKDALAEAAKQLSLA 617 FY ++ GK LAEAAKQ+ ++ Sbjct: 49 FYIPSFNLFGKGCLAEAAKQIKMS 72 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 26.2 bits (55), Expect = 5.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 47 PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVA 190 PP+ P+ + TN+ ++A G+ PP K++ RS+S N A Sbjct: 536 PPIVKPNLMSEPTPTNSDEKSHALGFPPPP--GQKIEFQRSSSKNGTA 581 >SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase subunit Dps1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 796 DQIVDHVDVRKGRDSTALCMFGGRVACLSNRVM*LLAS 683 D ++DH +VR+G S+ + FG R + L+ + AS Sbjct: 137 DDVIDHANVRRGSPSSNVA-FGNRRSILAGNFILARAS 173 >SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 143 DNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGESIWYNNVW 262 +NK+D N++ I+P +K+ E +D G Y+ W Sbjct: 67 ENKLDYIEDMGFNAIWISPIDKNIEGDID-GAGYAYHGYW 105 >SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 133 YDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Y QQN E Q HK D+ QE++ Sbjct: 600 YLGNQQNAVEGDQDHKKKGDKETTQEEK 627 >SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 991 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 17 RGNFYYNTPPPPLRYPSNPATAIFTNAQTYNN 112 RG Y N PP Y SN ++YNN Sbjct: 953 RGGGYSNGPPAGNHYSSNRGKGYGYQRESYNN 984 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,182,914 Number of Sequences: 5004 Number of extensions: 67412 Number of successful extensions: 288 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -