BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120415.Seq (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 26 0.35 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.47 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.81 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.4 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 3.3 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 23 4.3 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 26.2 bits (55), Expect = 0.35 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +2 Query: 104 YNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGESIWYNNV--WI 265 Y + P Y+ T+D ++ S +N+V A K+ E D + Y+ V W+ Sbjct: 454 YKSYPNYIDKETKDMNLEISTRPKSNTVENACVLKNTEIFKDKSDWFDYSEVSKWV 509 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 0.47 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 103 LQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 234 LQ++ R A +QQ + QQQ + + QQ+Q+ AR R Sbjct: 1198 LQEQQRNAAMVQQQQQQQQQQQQQQQ--QQQQQQQQQQHQARER 1239 Score = 25.0 bits (52), Expect = 0.81 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +1 Query: 82 HIHQRANLQQRARVRAAYDARQ--QNGHEPQQQHKLGSDRTVQQEQRTDARRRRIY 243 H Q+ QQ + + +Q Q +PQQQ + QQ+Q+ ++++ Y Sbjct: 1495 HSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQQQPQPQQQQQQQQQQQPQQQQKEY 1550 Score = 24.2 bits (50), Expect = 1.4 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 82 HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 H HQ + Q +A+ + +QQ PQQQ + + QQ+QR Sbjct: 815 HHHQSTHPQAQAQAQPQQQQQQQQQQ-PQQQQQ--QQQQQQQQQR 856 Score = 23.8 bits (49), Expect = 1.9 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 88 HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 HQ+ + Q +A A+ Q + QQQ + QQ+Q+ Sbjct: 811 HQQLHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQ 853 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.0 bits (52), Expect = 0.81 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 19/67 (28%) Frame = +2 Query: 113 APGYVPPTTRDNKMD-------------------TSRSNSTNSVAIAPYNKSKEPTLDAG 235 +PGYV P T+ K+D ++ SNS+NS + NK +E T++ Sbjct: 113 SPGYVQPPTKHQKLDQKFIFPQENNYNDNYFYSKSNGSNSSNSDVLFKQNKEEEQTINRK 172 Query: 236 ESIWYNN 256 S + +N Sbjct: 173 NSDYLDN 179 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +1 Query: 91 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Q+ + QQ+ + + +A+Q + QQQ + + QQ+Q+ Sbjct: 421 QQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQQQQ 462 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +1 Query: 91 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Q+ QQ+ + + N +PQQQ + + QQ+Q+ Sbjct: 416 QQMQAQQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQ 457 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/50 (24%), Positives = 28/50 (56%) Frame = +1 Query: 106 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 255 +Q+ +++A +QQ + Q QH + + + QQ+Q+ ++++ QQ Sbjct: 413 EQQQQMQAQQQHQQQ---QQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQ 459 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 254 CCTK*IRRRRASVLCSCCTVR 192 C ++ RR +LC+CC R Sbjct: 392 CWSRDFRRAFVRILCACCPGR 412 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 22.6 bits (46), Expect = 4.3 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 103 LQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 +++R R + + R + + QQQ + D+ QQ+ R Sbjct: 72 MREREREQREHSDRVTSQQQQQQQQQQQQDQQQQQQSR 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,935 Number of Sequences: 438 Number of extensions: 5006 Number of successful extensions: 29 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -