BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120414.Seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U85962-1|AAC51331.2| 2442|Homo sapiens CREB-binding protein prot... 36 0.14 U47741-1|AAC51770.1| 2442|Homo sapiens CREB-binding protein prot... 36 0.14 AB210043-1|BAE06125.1| 2472|Homo sapiens CREBBP variant protein ... 36 0.14 L09190-1|AAA65582.1| 1898|Homo sapiens trichohyalin protein. 35 0.31 AL589986-1|CAH70024.1| 1943|Homo sapiens trichohyalin protein. 35 0.31 AM156947-1|CAJ42307.1| 1221|Homo sapiens centrosome and spindle ... 31 3.8 AJ583433-1|CAE47426.1| 876|Homo sapiens centrosome spindle pole... 31 3.8 Y08267-1|CAA69593.1| 238|Homo sapiens AAD10 protein. 31 5.1 AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein. 31 5.1 AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein. 31 5.1 AB209494-1|BAD92731.1| 2704|Homo sapiens myeloid/lymphoid or mix... 31 5.1 U80756-1|AAB91448.1| 169|Homo sapiens polyglutamine rich protei... 30 6.7 BC146765-1|AAI46766.1| 1531|Homo sapiens nuclear factor of activ... 30 6.7 BC131509-1|AAI31510.1| 1548|Homo sapiens NFAT5 protein protein. 30 6.7 AB020634-1|BAA74850.2| 1608|Homo sapiens KIAA0827 protein protein. 30 6.7 >U85962-1|AAC51331.2| 2442|Homo sapiens CREB-binding protein protein. Length = 2442 Score = 35.9 bits (79), Expect = 0.14 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = +2 Query: 38 TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 217 TPP P P+ P+T + ++ QT PG VP T+ T ++ + V P + Sbjct: 878 TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 936 Query: 218 PTLDAGES 241 P++ +S Sbjct: 937 PSVATPQS 944 >U47741-1|AAC51770.1| 2442|Homo sapiens CREB-binding protein protein. Length = 2442 Score = 35.9 bits (79), Expect = 0.14 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = +2 Query: 38 TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 217 TPP P P+ P+T + ++ QT PG VP T+ T ++ + V P + Sbjct: 878 TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 936 Query: 218 PTLDAGES 241 P++ +S Sbjct: 937 PSVATPQS 944 >AB210043-1|BAE06125.1| 2472|Homo sapiens CREBBP variant protein protein. Length = 2472 Score = 35.9 bits (79), Expect = 0.14 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = +2 Query: 38 TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 217 TPP P P+ P+T + ++ QT PG VP T+ T ++ + V P + Sbjct: 908 TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 966 Query: 218 PTLDAGES 241 P++ +S Sbjct: 967 PSVATPQS 974 >L09190-1|AAA65582.1| 1898|Homo sapiens trichohyalin protein. Length = 1898 Score = 34.7 bits (76), Expect = 0.31 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 49 AAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDAR 228 A E L S GH + +++ R R + R++ E QQQ + DR Q+E+ + R Sbjct: 188 AEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWR 247 Query: 229 RRRIYL 246 +R L Sbjct: 248 KRETVL 253 >AL589986-1|CAH70024.1| 1943|Homo sapiens trichohyalin protein. Length = 1943 Score = 34.7 bits (76), Expect = 0.31 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 49 AAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDAR 228 A E L S GH + +++ R R + R++ E QQQ + DR Q+E+ + R Sbjct: 188 AEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWR 247 Query: 229 RRRIYL 246 +R L Sbjct: 248 KRETVL 253 >AM156947-1|CAJ42307.1| 1221|Homo sapiens centrosome and spindle pole associated protein 1 protein. Length = 1221 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/51 (23%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = +1 Query: 91 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQ--QEQRTDARRRR 237 +R +QRAR++ Y+ Q+ E +++ +L ++ ++ +E++ +A R++ Sbjct: 765 ERRLAEQRARIQQEYEEEQEKKREKEEEQRLKNEEHIRLAEERQKEAERKK 815 >AJ583433-1|CAE47426.1| 876|Homo sapiens centrosome spindle pole associated protein protein. Length = 876 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/51 (23%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = +1 Query: 91 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQ--QEQRTDARRRR 237 +R +QRAR++ Y+ Q+ E +++ +L ++ ++ +E++ +A R++ Sbjct: 420 ERRLAEQRARIQQEYEEEQEKKREKEEEQRLKNEEHIRLAEERQKEAERKK 470 >Y08267-1|CAA69593.1| 238|Homo sapiens AAD10 protein. Length = 238 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 91 QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Q LQ Q+ R++ A +QQ + QQQH LG QQ+Q+ Sbjct: 28 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 70 >AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein. Length = 4957 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 91 QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Q LQ Q+ R++ A +QQ + QQQH LG QQ+Q+ Sbjct: 3137 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 3179 >AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein. Length = 5262 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 91 QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Q LQ Q+ R++ A +QQ + QQQH LG QQ+Q+ Sbjct: 3442 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 3484 >AB209494-1|BAD92731.1| 2704|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia 2 variant protein. Length = 2704 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 91 QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 216 Q LQ Q+ R++ A +QQ + QQQH LG QQ+Q+ Sbjct: 884 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQ 926 >U80756-1|AAB91448.1| 169|Homo sapiens polyglutamine rich protein protein. Length = 169 Score = 30.3 bits (65), Expect = 6.7 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 91 QRANLQ-QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 213 Q LQ Q+ R++ A +QQ + QQQH LG QQ+Q Sbjct: 44 QERQLQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQ 85 >BC146765-1|AAI46766.1| 1531|Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive protein. Length = 1531 Score = 30.3 bits (65), Expect = 6.7 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +2 Query: 32 YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKS 211 Y+ P L+ P + T++ + +QT G PP ++ S+S+ A + + S Sbjct: 28 YDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTS 87 Query: 212 KEPTL 226 PT+ Sbjct: 88 SSPTI 92 >BC131509-1|AAI31510.1| 1548|Homo sapiens NFAT5 protein protein. Length = 1548 Score = 30.3 bits (65), Expect = 6.7 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +2 Query: 32 YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKS 211 Y+ P L+ P + T++ + +QT G PP ++ S+S+ A + + S Sbjct: 46 YDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTS 105 Query: 212 KEPTL 226 PT+ Sbjct: 106 SSPTI 110 >AB020634-1|BAA74850.2| 1608|Homo sapiens KIAA0827 protein protein. Length = 1608 Score = 30.3 bits (65), Expect = 6.7 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +2 Query: 32 YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKS 211 Y+ P L+ P + T++ + +QT G PP ++ S+S+ A + + S Sbjct: 105 YDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTS 164 Query: 212 KEPTL 226 PT+ Sbjct: 165 SSPTI 169 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,746,642 Number of Sequences: 237096 Number of extensions: 2256005 Number of successful extensions: 8684 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 6961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8053 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -