BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120413.Seq (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding pr... 25 3.4 AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding pr... 25 3.4 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 6.0 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 6.0 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 7.9 >AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding protein AgamOBP4 protein. Length = 150 Score = 24.6 bits (51), Expect = 3.4 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +2 Query: 20 VFCIHCVLERVDG 58 +FC+ C++E +DG Sbjct: 13 LFCVQCLIEHIDG 25 >AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding protein protein. Length = 150 Score = 24.6 bits (51), Expect = 3.4 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +2 Query: 20 VFCIHCVLERVDG 58 +FC+ C++E +DG Sbjct: 13 LFCVQCLIEHIDG 25 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 6.0 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 484 VTYKYLIYVGVVRGNLIDVNAKPNTYTVKLLPGTFGNDYRIMLKPRRF 341 VT + + + LIDVN K T L DY++ +P+ + Sbjct: 45 VTDALTVKIKLKLSQLIDVNLKNQIMTTNLWVEQTWYDYKLKWEPKEY 92 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 6.0 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -2 Query: 466 IYVGVVRGNLIDVNAKPNTYTVKLLPGTFGNDYRIMLKP 350 + +G+ LIDVN K T + NDY++ P Sbjct: 51 VKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNP 89 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 145 TMPPKNCTHLGG 110 TMPPK C+H G Sbjct: 556 TMPPKGCSHDDG 567 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,803 Number of Sequences: 2352 Number of extensions: 15891 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -