BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120412.Seq (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 25 0.63 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.8 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 25.0 bits (52), Expect = 0.63 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 364 IYVGVVRGNLIDVNAKPNTYTVKLLPGTFGNDYRIMLNRD 245 + +G+ LIDVN K T + NDY++ N D Sbjct: 48 VKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPD 87 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 384 PSSFHCNVNGN 416 P++F CNV GN Sbjct: 324 PATFTCNVRGN 334 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 Query: 445 RFFDSAFIYKFPFTLQWKDDGVTYKYLI 362 ++F+ + + F L + + GVTYK+ I Sbjct: 47 KYFEQT-LNELNFNLNYVNKGVTYKHTI 73 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,999 Number of Sequences: 438 Number of extensions: 3724 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -