BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120411.Seq (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 38 3e-04 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 26 1.0 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 26 1.0 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 3.2 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 9.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 37.9 bits (84), Expect = 3e-04 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +3 Query: 342 EVTVXGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 506 +V V G + ++ FE + + V V+ Y +PTPIQ PI ++G++L+ Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLM 215 Score = 34.7 bits (76), Expect = 0.003 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +2 Query: 512 AQTGSGKTLAYILPAIVH-INNQPPIR-RGDGPIALVLAPT 628 AQTGSGKT A++LP I H ++ + + R P +++APT Sbjct: 218 AQTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPT 258 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 26.2 bits (55), Expect = 1.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 491 WKEFSWVAQTGSGKTLAYILPAIVHINNQPPIRRGDG 601 +K ++ AQ + ++ I A+V + Q +RR DG Sbjct: 456 YKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 95 TVVPNLEEATNSAIIRLDLATVAVDLEDLEDLVGKKNSLE 214 T++ +L+E S + LDL +D +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.6 bits (51), Expect = 3.2 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 7/45 (15%) Frame = -1 Query: 271 FLLKG*VKQNPNL---GDACSDLQRILF----SHQILQILQIYCH 158 F+ KG ++ +PN GDA D++ +LF S +I +Q CH Sbjct: 926 FVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 149 LATVAVDLEDLEDLVGKKNSLEVRTCVAQIGIL 247 L +A+D+ L+ +GKK +L V + +G + Sbjct: 176 LMAIAIDMNPLKPRMGKKATLCVAASIWIVGTI 208 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,191 Number of Sequences: 2352 Number of extensions: 14181 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -