BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120406.Seq (749 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0110 - 5371536-5372882 31 0.98 12_01_0318 - 2425178-2425267,2425830-2426008,2426594-2426654,242... 29 3.0 02_01_0599 - 4455151-4455915,4455999-4456098,4456176-4456222,445... 29 3.0 11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802,906... 29 3.9 01_06_1094 - 34478538-34478624,34478860-34478931,34479154-344792... 29 3.9 11_04_0191 - 14692104-14692484 28 6.9 03_05_0830 + 28034179-28035492 28 9.1 01_06_1510 - 37859664-37861319 28 9.1 >10_02_0110 - 5371536-5372882 Length = 448 Score = 31.1 bits (67), Expect = 0.98 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Frame = -3 Query: 339 ITPDLVMSTVCGCKY----SG-SPCFATLSGAWSGFGRHAQTSICTCRRRGHVLPVHNLH 175 I+PD +S + +Y +G S C+ G+ G R Q S+CT R R H L VH Sbjct: 320 ISPDGKLSFIVTSRYFDGSAGVSSCYHLAFGSNGGCTRE-QVSVCTWRVRLHELRVHRSD 378 Query: 174 ILNC-WRC 154 +N W C Sbjct: 379 AMNLRWFC 386 >12_01_0318 - 2425178-2425267,2425830-2426008,2426594-2426654, 2426851-2427160,2428514-2428777,2432595-2433865 Length = 724 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 545 FVCQRNDCGSTRR*NGSARLRKRAP 619 FVC R C RR G ARLR+ +P Sbjct: 430 FVCSRLACALLRRRRGRARLRRASP 454 >02_01_0599 - 4455151-4455915,4455999-4456098,4456176-4456222, 4456566-4456612,4457299-4457461,4458013-4458042 Length = 383 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/69 (24%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +2 Query: 335 VIQLIMKSKLPYAIELQEWLL--EEVIPQV--LCTGKYAPAVEMDTNDVIAKIDDLTQKL 502 V+ ++ + + +EL+E E ++ Q+ ++AP+VE +V A I+ +T+K+ Sbjct: 268 VMAILKNRREKFTLELKELQRKRENLLAQMGDPSANRHAPSVEHSLAEVAAHIEAVTEKI 327 Query: 503 TVPTQIWRK 529 + + W+K Sbjct: 328 IMEEEKWKK 336 >11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802, 9060606-9060720,9061781-9061907,9062915-9062990, 9064247-9064365,9065430-9065593,9065666-9065779, 9065966-9066065,9066276-9066340,9068175-9068253, 9069513-9069659,9069904-9070161,9070657-9070852, 9071179-9071402,9072531-9072554 Length = 793 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 337 HARFGNEHCVWVQIQRVALLCHA 269 H FG++H + VQ+Q A++CHA Sbjct: 203 HIVFGSQHNLPVQLQAKAVICHA 225 >01_06_1094 - 34478538-34478624,34478860-34478931,34479154-34479222, 34479312-34479422,34480390-34480528,34480590-34480705, 34480821-34480968,34481058-34481215,34481654-34481827, 34482592-34483056 Length = 512 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 638 WPAAPFPARVFAI-LPSRFS 582 WPAAP P RV+ +PSRF+ Sbjct: 106 WPAAPAPLRVYVYEMPSRFT 125 >11_04_0191 - 14692104-14692484 Length = 126 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 573 RRDAETARQDCENAR-RKRRSWPTAWRT 653 RR + TA C R R+RRS PT WR+ Sbjct: 10 RRSSVTAHGGCGKQRWRQRRSRPTRWRS 37 >03_05_0830 + 28034179-28035492 Length = 437 Score = 27.9 bits (59), Expect = 9.1 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 6/75 (8%) Frame = +2 Query: 371 AIELQEWLLEEV--IPQVLCTGKYAPAVEMDTNDVIAKIDDLTQKL---TVPTQI-WRKQ 532 AIEL +L V I + GKY + DT + +DD + L V T I W Sbjct: 268 AIELSAEILANVKFIQEKKLIGKYFEEISQDTGKYVFGVDDTLKTLEMGAVETLIVWENL 327 Query: 533 PIAHFVCQRNDCGST 577 + +V + + G T Sbjct: 328 DVNRYVLKNSATGET 342 >01_06_1510 - 37859664-37861319 Length = 551 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 301 APTHSAHYQIWRDSTDNEVQIALRHRITRMA 393 AP H H+Q++R S +ALRHR R A Sbjct: 24 APAHG-HHQVFRCSAAKPSPLALRHRAGRPA 53 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,088,994 Number of Sequences: 37544 Number of extensions: 506842 Number of successful extensions: 1744 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1744 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -