BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120406.Seq (749 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22181-4|CAA80182.1| 824|Caenorhabditis elegans Hypothetical pr... 30 1.5 >Z22181-4|CAA80182.1| 824|Caenorhabditis elegans Hypothetical protein ZK632.5 protein. Length = 824 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Frame = +3 Query: 138 RFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHADQIQTML-QIAWQ---SRATRCICT 305 R +D +SLK V+ + + V +DG+YK ++ + Q+AW + TR + Sbjct: 93 RLSDEDFENSLKEVSLSQKLMVRIDGEYKYRLYSKPIVRNNIPQLAWDISPALRTRKVAE 152 Query: 306 HTQCSLPN 329 + S PN Sbjct: 153 KDEISPPN 160 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,949,959 Number of Sequences: 27780 Number of extensions: 403236 Number of successful extensions: 1153 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -