BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120404.Seq (806 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) 30 1.9 SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 29 3.4 SB_25084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_23572| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-22) 28 7.7 SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) 28 7.7 >SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) Length = 930 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 200 STDTKVKFPYAALSYINVSCAPTRPCWWDTWQH--STNLNIYNTGFCCR 340 S+ K P + + +S + + C+ S NLN Y+TG CCR Sbjct: 338 SSSPSTKPPKSPIRLCRISLSTSPSCYQQISSQCPSLNLNCYSTGICCR 386 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 599 LSICQIMLYGYIVCFSYEFYYCY 667 L C Y Y C+ Y +YYCY Sbjct: 467 LRYCYCYCYCYYYCYCYCYYYCY 489 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 Query: 608 CQIMLYGYIVCFSYEFYYCY 667 C Y Y C+ Y +YYCY Sbjct: 474 CYCYYYCYCYCYYYCYYYCY 493 >SB_25084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 401 ASVVLNA-VHKVGAFSATDIKNDNRNQYCKYSNSLNVAMYPTN 276 A +V+N +HK G S I+ D KY +VA+YPTN Sbjct: 306 APIVINRELHKGGDRSCMHIELDITGSGIKYDAGDHVAVYPTN 348 >SB_23572| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-22) Length = 269 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 286 YMATFNEFEYLQYWFLLSFLMSVALNAPTLWTAFKTTEAHEV 411 Y F L LS ++SVA N LWT F T H V Sbjct: 9 YQENLESFILLSVLSTLSGIVSVAGNFLVLWTIFHTKSLHVV 50 >SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) Length = 210 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 325 WFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNY 468 W + F+ + N+P LW T EVV + +L A N ++ + Sbjct: 127 WLFVLFINDLECNSPHLWKYVDDTTVSEVVLKGELSSAQGLVNDIIEW 174 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,178,444 Number of Sequences: 59808 Number of extensions: 514846 Number of successful extensions: 1330 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1303 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -