BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120403.Seq (837 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 2.0 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 6.1 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.8 bits (49), Expect = 2.0 Identities = 16/84 (19%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = -1 Query: 528 GSSQLLPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG-VLNGDERFRH 352 G+ Q +P S+ + L+ + + + Q NSP + P H+G + R Sbjct: 25 GTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAART 84 Query: 351 VTTLHAWNETPCARRYYRPRTASA 280 ++++ + A +++ + A A Sbjct: 85 TSSMYPYVSAAAAHHHHQQQQAVA 108 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 6.1 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -2 Query: 275 RVSNETMK*WFFSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 129 R+S + +K +D R SP TP+ + Y +E+ + S F D+P Sbjct: 13 RISPQILK----NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,279 Number of Sequences: 438 Number of extensions: 5292 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -