BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120403.Seq (837 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 3.8 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 5.1 At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containi... 28 6.7 At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138... 28 6.7 At3g62370.1 68416.m07006 expressed protein 28 8.8 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 206 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 96 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 438 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 322 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 907 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 521 ASFCLLLHARFLSSLSWP 468 ASFC+L+HA ++L WP Sbjct: 105 ASFCILIHALVKANLFWP 122 >At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 568 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -3 Query: 778 VSRRSNPAHVPF*WVNNPTLGEILFAMIGRADIEGSKSNVAMNAWLPQ 635 V RR +P V +P + + L+ ++ AD+ GS NV M AW P+ Sbjct: 97 VYRRGSPGSV----YRSPKVFKRLWPVM-EADVNGSSHNVLMEAWKPR 139 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 423 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 328 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,613,567 Number of Sequences: 28952 Number of extensions: 411817 Number of successful extensions: 1122 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -