BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120402.Seq (801 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_25768| Best HMM Match : tRNA_int_endo_N (HMM E-Value=9.2) 28 7.7 >SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Frame = +3 Query: 243 LKMFRHINDDMRLCICWGLC*YV---YKIPSWIFIGHRWCWSNAHVNCHTR*WKEH*LT 410 L M+ N+D+RLCI G Y+ +I W I +W ++ NC+ K++ +T Sbjct: 375 LSMYLESNNDLRLCINNGYKNYLTQNLRIGQWNNICTQWRSTDGEYNCYINGEKKYGVT 433 >SB_25768| Best HMM Match : tRNA_int_endo_N (HMM E-Value=9.2) Length = 247 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = +3 Query: 630 TLVNLFMQSHFLYQAHLYLGLMLMCGFVLFDTQLILEKRRMGSKA 764 T+ L + +H +Y + + + +++DT++I+ + R+GS A Sbjct: 34 TMTQLRIGAHVVYDTEATITRIRLGAHIVYDTEVIITRIRLGSHA 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,115,493 Number of Sequences: 59808 Number of extensions: 506073 Number of successful extensions: 975 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -