BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120400.Seq (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 26 0.37 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.85 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 2.0 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 2.0 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.0 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 25.8 bits (54), Expect = 0.37 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -2 Query: 146 PAGARRRLATDLTSATTPCVCEQIRQKA--SPLSKFR*HLQCSNNPVRHA 3 P G A +LT +T CE + S FR +QCSN+P+R A Sbjct: 22 PGGFVMEDANNLTQSTILTTCESNTDFSFGSKTIDFR-KIQCSNSPLRKA 70 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.85 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 359 VCAPEVDERAQPAVPEQCAPE 297 V PEVD+ +QP P Q P+ Sbjct: 1091 VVMPEVDKPSQPCEPGQYVPD 1111 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 134 RRRLATDLTSATTPCVCEQIRQKASPLSK 48 R RL +TSA TP V ++ PL++ Sbjct: 272 RARLRKQITSAATPLVRSYAPERYPPLAQ 300 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 268 RAAGCARSSTSGAHCSGTAGCARSSTSGAHTGRT 369 R A C S G G G +S+ GA GRT Sbjct: 140 RPAACTPDSRVGYGSVGLVGGDPASSPGAAAGRT 173 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/36 (22%), Positives = 14/36 (38%) Frame = -2 Query: 566 NTCSMHVXXXXXXXXXGTRECAQVAARKQCAQPAVR 459 N C + + ++C V R +C P V+ Sbjct: 228 NNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQ 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,611 Number of Sequences: 336 Number of extensions: 2258 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -