BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120389.Seq (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 565 FILHTAAVSVEDCCSGMFTCL 503 F+LH+ AV +E +G+ CL Sbjct: 1079 FVLHSLAVELEHGAAGLRLCL 1099 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = +2 Query: 527 TIFYRNCGRVQNEKLLK*TGIELLTTNSNMDQLNCYCKFSWK 652 TI C +NE ++ I+++T ++LN WK Sbjct: 479 TILQNACFCARNELMMILKEIKIITDQLKSEELNAKVTNDWK 520 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,536 Number of Sequences: 438 Number of extensions: 4603 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -