BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120385.Seq (730 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68014-4|CAA92026.2| 588|Caenorhabditis elegans Hypothetical pr... 28 5.9 Z29094-16|CAA82345.2| 184|Caenorhabditis elegans Hypothetical p... 28 7.9 >Z68014-4|CAA92026.2| 588|Caenorhabditis elegans Hypothetical protein W04G3.4 protein. Length = 588 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -3 Query: 491 ISNIFEYEFVVLEHNLSTVHVINAETKTKLGHINVSLNQNDPNV 360 +SNI Y V+ HN T+ +N KT ++ + L + N+ Sbjct: 484 VSNIHSYVLVIQNHNNFTIKDVNLSLKTNDKNVIIRLQDSVNNL 527 >Z29094-16|CAA82345.2| 184|Caenorhabditis elegans Hypothetical protein C07A9.9 protein. Length = 184 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -3 Query: 164 KYNQVDDHVV----CEYCEAEIKNWSEDECIEYAHVTLSPYCAY 45 +Y VDD V C +C W D+C + H +L +C Y Sbjct: 59 EYQYVDDDVPNSERCHFCMKRKGRWMGDDCSD--HSSLCKHCCY 100 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,702,107 Number of Sequences: 27780 Number of extensions: 310259 Number of successful extensions: 810 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -