BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120382.Seq (779 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 2.1 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 2.1 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 2.1 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 23 2.7 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.8 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = -1 Query: 347 NNNFITSYFSFHTYLHSNLHY-----FHINCASPTFVYTQPIM*ILNLQ 216 N+N +++ + + Y H LH H P TQP+ LN Q Sbjct: 71 NSNVLSNGYGYGNYYHPQLHSHHGPPIHHQIRPPILHDTQPMCESLNTQ 119 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = -1 Query: 347 NNNFITSYFSFHTYLHSNLHY-----FHINCASPTFVYTQPIM*ILNLQ 216 N+N +++ + + Y H LH H P TQP+ LN Q Sbjct: 71 NSNVLSNGYGYGNYYHPQLHSHHGPPIHHQIRPPILHDTQPMCESLNTQ 119 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = -1 Query: 347 NNNFITSYFSFHTYLHSNLHY-----FHINCASPTFVYTQPIM*ILNLQ 216 N+N +++ + + Y H LH H P TQP+ LN Q Sbjct: 71 NSNVLSNGYGYGNYYHPQLHSHHGPPIHHQIRPPILHDTQPMCESLNTQ 119 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 347 NNNFITSYFSFHTYLHSNLHYFH 279 N+N +++ + + Y H LH H Sbjct: 71 NSNVLSNGYGYGNYYHPQLHSHH 93 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -1 Query: 377 LTIILYFIKDNNNFITSYFSFHTYLHSNLHYFHINCASPTFVY 249 LT + +NF + +++ L+ + FHIN A +Y Sbjct: 311 LTFWIIVAPAGSNFEIGFENYYNILYFSRIMFHINSAVNPILY 353 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,072 Number of Sequences: 336 Number of extensions: 3726 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -