BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120379.Seq (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 26 0.29 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 26 0.39 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 25 0.51 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.1 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 23 2.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.1 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 22 6.3 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.3 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 26.2 bits (55), Expect = 0.29 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = -3 Query: 176 DCSDNTSDDTSPCSTDYHEASALDLVQSLDEISSCDSSNFSQSRDISPVNNQLKKKK 6 DC D +S S + + +VQSLD SS D N S+ +S N LKK K Sbjct: 29 DCDDVSSVSQSEAGDEDRFSFTSSMVQSLDGNSS-DLENSSEENCVSMSN--LKKLK 82 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 25.8 bits (54), Expect = 0.39 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = -3 Query: 182 RPDCSDNTSDDTSPCSTDYHEASALDLVQSLDEISSCDSSNFSQSRDISPVN 27 +PDC D + +++ TD + A D Q + C + + P N Sbjct: 138 KPDCKDESDENSCTVETDPNRAPDCDPTQCVLPDCFCSADGTRIPGQLEPAN 189 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 25.4 bits (53), Expect = 0.51 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = -3 Query: 182 RPDCSDNTSDDTSPCSTDYHEASALDLVQSLDEISSCDSSNFSQSRDISPVN 27 +PDC D + +++ TD + A D Q + C + + P N Sbjct: 131 KPDCKDESDENSCTVETDPNRALDCDPTQCVLPDCFCSADGTRIPGQLEPAN 182 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 699 EDSFMSAWDYKPNIIMDRVNNNEIFYDGVPLI 604 ED++M A + D V N FYDG PLI Sbjct: 1151 EDNYMEAPQDNVSQPSDEVMENSWFYDG-PLI 1181 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 699 EDSFMSAWDYKPNIIMDRVNNNEIFYDGVPLI 604 ED++M A + D V N FYDG PLI Sbjct: 1151 EDNYMEAPQDNVSQPSDEVMENSWFYDG-PLI 1181 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 266 IWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 266 IWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 266 IWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 222 IWFQNRRMKWKKEHKMASMNIVPYHMS 248 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 266 IWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 54 IWFQNRRMKWKKEHKMASMNIVPYHMS 80 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 266 IWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -3 Query: 101 VQSLDEISSCDSSNFSQSRDISPVNNQLK 15 +Q +DE + NF++ + +N LK Sbjct: 69 LQMIDEWGDIEKGNFAEVEALKEINPNLK 97 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/38 (26%), Positives = 14/38 (36%) Frame = -1 Query: 346 HPISSNIVSSDKQVSNIDFCENRESSTETEDYSTPIYQ 233 H + +V D N+ CEN S +YQ Sbjct: 607 HLAKTRVVHRDLAARNVLVCENHTVKVSDFGLSRDVYQ 644 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,188 Number of Sequences: 336 Number of extensions: 3486 Number of successful extensions: 16 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -