BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120379.Seq (781 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 27 0.49 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 27 0.49 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 6.1 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 23 8.0 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 27.5 bits (58), Expect = 0.49 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Frame = -3 Query: 281 SRIVNRNGRLFNADISNDVTSSLAFVPSSKSSQRPDCSDNTSD----DTSPCSTDYHEAS 114 S IV+R R FN S+ VTS P ++ D TS DT T +H S Sbjct: 536 SSIVSRR-RFFNTSASSSVTSEGTITPDLQTFDYHDEGGETSSVYSCDTEGYYTSFHVDS 594 Query: 113 ALDLVQSLDEISSCDSS 63 L ++ + ++ S+ Sbjct: 595 GLKTLKEEEPMTPLQST 611 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 27.5 bits (58), Expect = 0.49 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Frame = -3 Query: 281 SRIVNRNGRLFNADISNDVTSSLAFVPSSKSSQRPDCSDNTSD----DTSPCSTDYHEAS 114 S IV+R R FN S+ VTS P ++ D TS DT T +H S Sbjct: 537 SSIVSRR-RFFNTSASSSVTSEGTITPDLQTFDYHDEGGETSSVYSCDTEGYYTSFHVDS 595 Query: 113 ALDLVQSLDEISSCDSS 63 L ++ + ++ S+ Sbjct: 596 GLKTLKEEEPMTPLQST 612 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 6.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 498 IYSIHLVLRLVFHSEVNKTLIQCYHYCKLTMDR 596 +Y +LR H E N+TL + H+ ++ D+ Sbjct: 1940 LYDKQGILRFSLHKEHNETLDRVIHFTYVSDDK 1972 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 8.0 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -1 Query: 538 LWNTKRRTRWIEYMPLTDLDTIPQYMS 458 +W RR +W + + ++ +P +MS Sbjct: 326 IWFQNRRMKWKKEHKMASMNIVPYHMS 352 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,064 Number of Sequences: 2352 Number of extensions: 13268 Number of successful extensions: 73 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -