BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120378.Seq (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 27 0.15 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 1.9 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 4.4 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 4.4 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 4.4 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 4.4 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 4.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 4.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 4.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 4.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 4.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 4.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 4.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.4 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 5.8 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 21 7.6 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 7.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.6 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 7.6 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 7.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 27.1 bits (57), Expect = 0.15 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -1 Query: 183 SFPLWLVVVAARIANLAFSCHATDVRCLLWFKSN*SVSQNIRYIIN 46 +FP+W V + AR+ L+ + RC + + VS N +++ Sbjct: 904 TFPVWQVTLNARLVELSLGSNPWSCRCKFLQELSSWVSDNAHKVVD 949 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.9 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNNNGAAFNVKQTKRA*CAILRRRPFN 300 RK ++S + ++ ++ER +S E + + +NN +N K+ C R+ +N Sbjct: 57 RKYRETSKERSRDRKEREKSKEHKIISSLSNNYN--YNNNNYKKLYCNNYRKLYYN 110 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNNNGAAFNVKQTKRA*CAILRRRPFN 300 RK ++S + ++ ++ER +S E + + +NN +N K+ C ++ +N Sbjct: 57 RKYRETSKERSRDRKEREKSKEHKIISSLSNNYN--YNNNNYKKLYCNNYKKLYYN 110 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNNNGAAFNVKQTKRA*CAILRRRPFN 300 RK ++S + ++ ++ER +S E + + +NN +N K+ C ++ +N Sbjct: 57 RKYRETSKERSRDRKEREKSKEHKIISSLSNNYN--YNNNNYKKLYCNNYKKLYYN 110 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK + S + ++ KRER S E + + +NN Sbjct: 57 RKYRERSKERSRDKRERERSKERKIISSLSNN 88 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK + S + ++ KRER S E + + +NN Sbjct: 57 RKYRERSKERSRDKRERERSKERKIISSLSNN 88 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNN 88 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 495 VVLEPPTARLRTPSVQECRASLRILVFRLWN 587 + L+ TAR P+V +C A + LWN Sbjct: 781 IKLKNQTARRGEPAVLQCEAQGEKPIGILWN 811 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 484 SGSGYNLSSHSCKLFKLASRQNS 416 SGS NLSS S ASR+N+ Sbjct: 603 SGSAENLSSGSNNQTSSASRENT 625 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 133 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNN 228 RK ++S + ++ +RER S E + + +NN Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIVSSLSNN 88 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 21.4 bits (43), Expect = 7.6 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = -3 Query: 592 LWFQSRKTKIRR 557 +WFQ+R+TK ++ Sbjct: 54 IWFQNRRTKWKK 65 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +1 Query: 493 SWCWSRQRQDYVHHR 537 +W W +RQ Y H+ Sbjct: 172 AWSWREERQAYYLHQ 186 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 442 IVCTNGKTSCIPSPIKISWC 501 +V ++G SC+PS ++ C Sbjct: 150 LVFSSGSVSCVPSVKHVAKC 169 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 469 NLSSHSCKLFKLASRQNSFFKNLPSKQLQ 383 N S +L K A N F KNL Q++ Sbjct: 84 NKRDRSRELIKAAILANDFMKNLELTQIR 112 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +1 Query: 493 SWCWSRQRQDYVHHR 537 +W W +RQ Y H+ Sbjct: 172 AWSWREERQAYYLHQ 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,926 Number of Sequences: 438 Number of extensions: 4528 Number of successful extensions: 29 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -