BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120378.Seq (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOA... 31 0.65 At1g63500.1 68414.m07180 protein kinase-related low similarity t... 31 0.65 At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family pr... 29 2.0 At5g55360.1 68418.m06898 long-chain-alcohol O-fatty-acyltransfer... 29 3.4 At3g05390.1 68416.m00589 expressed protein ; expression supporte... 29 3.4 At2g29980.2 68415.m03647 omega-3 fatty acid desaturase, endoplas... 29 3.4 At2g29980.1 68415.m03646 omega-3 fatty acid desaturase, endoplas... 29 3.4 At1g76630.1 68414.m08916 tetratricopeptide repeat (TPR)-containi... 29 3.4 At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative ... 28 6.0 At1g48760.2 68414.m05457 delta-adaptin, putative similar to SP|O... 28 6.0 At1g48760.1 68414.m05456 delta-adaptin, putative similar to SP|O... 28 6.0 At5g47690.1 68418.m05887 expressed protein 27 7.9 At4g20190.1 68417.m02952 hypothetical protein 27 7.9 At1g65990.1 68414.m07488 type 2 peroxiredoxin-related / thiol sp... 27 7.9 At1g50180.1 68414.m05627 disease resistance protein (CC-NBS-LRR ... 27 7.9 At1g34520.1 68414.m04290 long-chain-alcohol O-fatty-acyltransfer... 27 7.9 >At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 341 Score = 31.1 bits (67), Expect = 0.65 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 203 WSSPLSTLSRFGWLSSLLESPILRLVAMLPTC 108 W S L +LS ++SS L +LRL+++LP C Sbjct: 12 WISALISLSYCYYISSKLSKGVLRLLSILPVC 43 >At1g63500.1 68414.m07180 protein kinase-related low similarity to protein kinase [Arabidopsis thaliana]; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 422 Score = 31.1 bits (67), Expect = 0.65 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 354 VKRGNFSILNCSCFEGRFLKNEFCRLANLNS-LHEWEDKLYPEPDKNIVVLEPPTARLRT 530 ++ N +L SC EG+F ++ L L S ++E + P P + + P L T Sbjct: 195 IRDRNIQMLIDSCLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVTAMIPLQKDLET 254 Query: 531 PSVQ 542 PS Q Sbjct: 255 PSHQ 258 >At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 335 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = +1 Query: 73 NTSIRLEPQQTAHVGSMATKRKIGDSSSDDNQPKRER-------VESGEDQQLVPYNNNN 231 ++ + + P+ T G+ KRK + D N+ K++ VE GE+++ NN Sbjct: 75 DSRLSISPETTLGTGNFK-KRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKITEQNN 133 Query: 232 GAAFNVKQTK 261 G+ ++K+ K Sbjct: 134 GSTKSIKKMK 143 >At5g55360.1 68418.m06898 long-chain-alcohol O-fatty-acyltransferase family protein / wax synthase family protein contains similarity to wax synthase similarity to wax synthase wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 342 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = -2 Query: 203 WSSPLSTLSRFGWLSSLLESPILRLVAMLPTCAV 102 W S + ++S +LS+ +++ + RL+++LP CA+ Sbjct: 12 WISAIISISYCYYLSTGIKAGVFRLLSVLPVCAL 45 >At3g05390.1 68416.m00589 expressed protein ; expression supported by MPSS Length = 463 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/65 (21%), Positives = 28/65 (43%) Frame = +3 Query: 273 CYFTPSSVQLEPRELTKMLWQEQMAINVKRGNFSILNCSCFEGRFLKNEFCRLANLNSLH 452 C S +P + + LW+ NV+ GN+ N +C + K + + + + Sbjct: 226 CLTRASMTYQKPYPINESLWKLPDDRNVRWGNYQCRNFACLSSKNPKRGYTKCSGCFEME 285 Query: 453 EWEDK 467 + +DK Sbjct: 286 KEKDK 290 >At2g29980.2 68415.m03647 omega-3 fatty acid desaturase, endoplasmic reticulum (FAD3) identical to SP:48623 Length = 288 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -2 Query: 311 AWLQLNGR-RRKIAHYARFVCFTLKAAPLLLLYGTSCWSSPLSTLSRFGWLSSLLESPIL 135 +W+ L R +K+ H R + +T+ P+L C+ SP S F SSL Sbjct: 152 SWVPLPERVYKKLPHSTRMLRYTVPL-PMLAYPLYLCYRSPGKEGSHFNPYSSLFAPSER 210 Query: 134 RLVAMLPTC 108 +L+A TC Sbjct: 211 KLIATSTTC 219 >At2g29980.1 68415.m03646 omega-3 fatty acid desaturase, endoplasmic reticulum (FAD3) identical to SP:48623 Length = 386 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -2 Query: 311 AWLQLNGR-RRKIAHYARFVCFTLKAAPLLLLYGTSCWSSPLSTLSRFGWLSSLLESPIL 135 +W+ L R +K+ H R + +T+ P+L C+ SP S F SSL Sbjct: 152 SWVPLPERVYKKLPHSTRMLRYTVPL-PMLAYPLYLCYRSPGKEGSHFNPYSSLFAPSER 210 Query: 134 RLVAMLPTC 108 +L+A TC Sbjct: 211 KLIATSTTC 219 >At1g76630.1 68414.m08916 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile: PF00515 TPR Domain (5 copies) Length = 1064 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 6/55 (10%) Frame = -2 Query: 293 GRRRKIAHYARFVCFTLKAAP--LLLLYGTSC----WSSPLSTLSRFGWLSSLLE 147 G RK+ LK +P + +LYG + WS L FGW +SLLE Sbjct: 203 GSYRKVTFGVELFEQALKISPQNISVLYGLASGLLSWSKECINLGAFGWAASLLE 257 >At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative similar to DNA-binding protein DF1 [Pisum sativum] GI:13646986 Length = 603 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 157 DDNQPKRERVESGEDQQLVPYNNNNGAAFN 246 D+++ + E G + +LVP NNNN N Sbjct: 572 DEDEEEENEEEEGGEFELVPSNNNNNKTTN 601 >At1g48760.2 68414.m05457 delta-adaptin, putative similar to SP|O14617 Adapter-related protein complex 3 delta 1 subunit (Delta-adaptin 3) {Homo sapiens}; contains Pfam profile: PF01602 Adaptin N terminal region Length = 869 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 79 SIRLEPQQTAHVGSMATKRKIGDSSSDDNQPKRERVESGEDQQLVP 216 S R+E Q + K+K G+ SS ++ V S +Q ++P Sbjct: 820 SSRIENHQNSEKKKKKKKKKKGEGSSKHKSRRQNEVASASEQVIIP 865 >At1g48760.1 68414.m05456 delta-adaptin, putative similar to SP|O14617 Adapter-related protein complex 3 delta 1 subunit (Delta-adaptin 3) {Homo sapiens}; contains Pfam profile: PF01602 Adaptin N terminal region Length = 869 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 79 SIRLEPQQTAHVGSMATKRKIGDSSSDDNQPKRERVESGEDQQLVP 216 S R+E Q + K+K G+ SS ++ V S +Q ++P Sbjct: 820 SSRIENHQNSEKKKKKKKKKKGEGSSKHKSRRQNEVASASEQVIIP 865 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 130 KRKIGDSSSDDNQPKRERVESGEDQQLVPYN-NNNGAAFNVKQTK 261 KR +GD++S + PKR R SG PY +N+G +K ++ Sbjct: 1227 KRNVGDATSVVSVPKRRRSSSGHS----PYKFSNSGPKVQLKASE 1267 >At4g20190.1 68417.m02952 hypothetical protein Length = 389 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +3 Query: 441 NSLHEWEDKLYPEPDKNIVVLEPPTARLRTPSVQECRASLRILVFRLWNHKT 596 +S+H W+D+ + ++V + TA R+ S E RA L F + HK+ Sbjct: 99 SSIHNWKDRTTEQVLDLMLVQDAATAFRRSKSCGEGRACTPSLDFDMLLHKS 150 >At1g65990.1 68414.m07488 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein similar to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profiles PF00646: F-box domain, PF00578: AhpC/TSA family Length = 553 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 463 SSHSCKLFKLASRQNSFFKNLPSKQLQFSIEKLPRFTLIAI 341 S C LF+L + NLP+ L+ I ++PR + A+ Sbjct: 142 SGGDCSLFQLMKMTTTTMSNLPTDLLEEIISRVPRKYMRAV 182 >At1g50180.1 68414.m05627 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 857 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 357 KRGNFSILNCSCFEGRFLKNEFCRLANLNSLHEW 458 K N IL FEG F+ ++ C NL +L EW Sbjct: 753 KLPNLKILQL--FEGSFVGSKLCCSKNLENLEEW 784 >At1g34520.1 68414.m04290 long-chain-alcohol O-fatty-acyltransferase family protein / wax synthase family protein wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 287 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = -2 Query: 203 WSSPLSTLSRFGWLSSLLESPILRLVAMLPTCAVCCGSSLIEVF 72 W S + ++S ++ S ++S + RL+++LP C + L VF Sbjct: 12 WGSAIISVSYCYYIPSKIKSGVHRLLSVLPVCVLFLVLPLFFVF 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,662,890 Number of Sequences: 28952 Number of extensions: 316045 Number of successful extensions: 1031 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -