BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120377.Seq (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 25 0.68 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 4.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.8 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 23 4.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.3 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 25.4 bits (53), Expect = 0.68 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 38 HLRSVRFDFANALL-VCRPVAEHIYCKQLFVLLLPSSPITITLEITF 175 H RS R F + R VA H Y K+L + L+ + T+ +TF Sbjct: 132 HYRSKRRGFVYYTMGQIREVARHFYHKELQIELVREEILFDTVHVTF 178 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 468 VISESNVFNLVKITSL 421 VI+ S +FNLVKI+ L Sbjct: 296 VINFSGIFNLVKISPL 311 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 561 VEQHQLYFDQFSVEHHK 611 ++QH LY Q +HH+ Sbjct: 92 MQQHSLYLQQQQQQHHQ 108 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 468 VISESNVFNLVKITSL 421 VI+ S +FNLVKI+ L Sbjct: 46 VINFSGIFNLVKISPL 61 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 6.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 339 VWLRFIW 319 VWLRFIW Sbjct: 77 VWLRFIW 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,236 Number of Sequences: 438 Number of extensions: 3878 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -