BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120372.Seq (789 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 24 1.2 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 6.4 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -3 Query: 232 MYHTTFQRHTTSTKFYYVFVSS*TSPKTRRIAKQCSRHFT 113 +YH R T V+ PK + I K C+R FT Sbjct: 51 LYHKLQFRGPPRTPLQPKLVAGKLKPKRQFICKYCNRQFT 90 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 612 GVGPVGGITSLLGTMGN 662 G VGGI LGT+G+ Sbjct: 215 GTNLVGGIVRSLGTLGS 231 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,694 Number of Sequences: 336 Number of extensions: 3272 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -